SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT20590 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT20590
Domain Number 1 Region: 198-446
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-58
Family Protein kinases, catalytic subunit 0.00038
Further Details:      
 
Domain Number 2 Region: 144-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000215
Family EGF-type module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT20590
Sequence length 624
Comment pep:novel supercontig:GCA_000347335.1:Scaffold27213:15405:19218:-1 gene:F775_25361 transcript:EMT20590 description:""
Sequence
MSVCRPSWYALPGLCTGVGCCQSAIPPGISFFEPHQRKFPPHQDDNPTFISNAMSCHYVF
LVDTEWFTYSDLVFLNHTDDFDMPVVLDWAVRNVGNCSAARRNATDFACRSARSECFDAD
NGPGYRCNCSRGYDGNPYLDGGCTDIDDCQLKDEYSCYGVCTNSQGSYTCQCPPGTSGDA
TRKDGCRQKDKFTLALKWAAIKKSKMMEATETKEFAREMLILSQINHRNIVKLHGCCLEV
EVPMLVYEYVSNGTLYHYIHGGEGLDINKALDTRLRIAAESAEALSYMHSSASPPILHDD
VKTANILLDGSLAAKVSDVGASKLQPSDEAEIATLVQGTCGYLDPEYLMACQLTDKSDIY
SFGVVLLELLTGKKVLCFDGPEEDRSLVSRFTMAVKADQHDELLEDQVRTKMGPEALEEV
THLVMHCVSMIREERPSMKEVAEKLEALRSEIEAELVYRVPVVGRFIDLVHGPTSAPRRR
CVSCGYAGIPFVLNCFEPYQRNFPPGQNGGFCGCAGTPFVLNCCEPYQRNFPPGQNGGSD
LAFIINTTSCHYVFLVELDWFSYSDHVFLNRTDDFNVSVVLSWAMWSVGNCSTASRNATD
FAYRSARSECFNVTNGPKYRCSCS
Download sequence
Identical sequences R7WG37
EMT20590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]