SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT21031 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT21031
Domain Number 1 Region: 364-444
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000408
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 2 Region: 106-127
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000895
Family CCCH zinc finger 0.0048
Further Details:      
 
Weak hits

Sequence:  EMT21031
Domain Number - Region: 207-233
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000345
Family CCCH zinc finger 0.0033
Further Details:      
 
Domain Number - Region: 309-335
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000345
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT21031
Sequence length 500
Comment pep:novel supercontig:GCA_000347335.1:Scaffold26271:138731:141551:-1 gene:F775_32051 transcript:EMT21031 description:"E3 ubiquitin-protein ligase makorin "
Sequence
MSNRYRVFSAPLARSGASRPMIRAGLGGFVELEESVPMKSVAILVIELALAWQSMQFQIP
VLVQMQWYRAYNLTPGCNLVGENEGDGDFCRNRTGGHDFFVAFYVHQVCTFYQNGVCSYG
SRCRYEHVEVSSEYTPPSTTAALAPSNSYLSWCPLCEGEIDVSNQTHKSLSVCSVHQSTW
RFDDEDCIPEDGNSLSSALTAQNQALHPLAHLPICSFAAAGTCPYGKECPQMHGDPCTSC
GKQCLHPYRPSEGGAHIKLCKRNNKRLETLKKSEEMECSSTWRFDDEDCIPEDGNSLSSA
LTAQNQALHPLAHLPICSFAAAGTCPYGKECPQMHGDPCTSCGKQCLHPYRPSEGGAHIK
LCKRNNKRLETLKKSEEMECSVCLDRVLSKPTAAEKRFGLLPECDHAFCITCIRKWRSSS
LTSSMDIDSTVKACPICRKVSYYVIPSATWYSSKEEKQDIIDGYKAKLKSIDCRYFDFGR
DTCPFGGRCFYKQQFRMKPN
Download sequence
Identical sequences M8CD13
EMT21031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]