SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT24801 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT24801
Domain Number 1 Region: 293-460
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 2.36e-27
Family Shiga toxin, A-chain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT24801
Sequence length 482
Comment pep:novel supercontig:GCA_000347335.1:Scaffold17653:91434:96993:-1 gene:F775_00551 transcript:EMT24801 description:"Protein synthesis inhibitor I "
Sequence
MNTTSFCCVCIHCFATGSPCSAAGSPALPLSWLDTSSQAMLERRPQLWKQKHRGKAFMAL
IFFPAMLERRPQLWKQKHRGKAFMALIFFPVIVLLSGSSRTMSGLSTSALIPPVERNLPV
WHRPIIVQRGNKLLQRINQMEEEELAMGRNGTTQWSKSRVQTVADVVRSDVDRGDKEVQM
KNILESKPMASQFPSSATKQGIPEFFKDESLERPKFASLTTPGSMDRNNSGPIAGILRHM
MGQNVTYALLNHTEYFELVPLEEFNSGSSDYVNYSETEPNVLIEVLITTFAEKQPGPPAW
WISVEVKGEDIGRSALMYFRSDNIYLVGFMSGYGTLYCMDDATEMFPQGCTPLGFTGKYH
DLTGRENKQDDLSPFLRTGLLGRTAARYAANILVEYGVTIKAPELPKRALLIYTLMIPEA
LRFKPIRNQIKQSWLHPMTLTPEQYNIVFAWQDMSELFCRGDDITDQTPVWTKGAKGSPR
LT
Download sequence
Identical sequences M8CMS9
EMT24801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]