SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT26170 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT26170
Domain Number 1 Region: 98-192
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000236
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT26170
Sequence length 293
Comment pep:novel supercontig:GCA_000347335.1:Scaffold14671:7345:8226:-1 gene:F775_21748 transcript:EMT26170 description:"Uncharacterized protein "
Sequence
MGLLSYAAMCLSLAFLLQSYAAATAPTGMLERETKQQIIASIPPHGQENPVLFLTSPSGK
YAAHFMRSQTAPGAGGLGADFCYVEILDSTEPGAEGRSVWESECLAVSTVNTCALVFSWK
GLEVFDGSNSVWHTHDTESDDNNFLKTLQLVDEGDMRILDKGGELAWKASDEPRAAQHCG
MPGSPGLVSAMPPFAEPAGHGSSNLPFGQEPEGTGNAGVAQPTLPLPEAAGTGGVAGQGQ
ALEDVGQTIGFGSQPLVDNSPYDSGAPKHGCSLLGFGVALGVSSAAIAMALGL
Download sequence
Identical sequences M8BMF9
EMT26170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]