SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT28950 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT28950
Domain Number 1 Region: 76-189
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.81e-28
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT28950
Sequence length 320
Comment pep:novel supercontig:GCA_000347335.1:Scaffold9133:321:10169:1 gene:F775_42850 transcript:EMT28950 description:"Uncharacterized protein "
Sequence
MGLPLRLGLETLELSSVTPRFLPLCASDDRLVPGKPLRAGTTIVSDGGDFALGFFTTSNS
TSYLGIWYNGISELTAVWVANRETLVNNNTFSRPTLSLTNTSNLVLSNGNGTGRVIWTTN
NIATAPGSSPSTAVLLNTGNLVLRSPNGTMLWQSFDHPTDTFLPGMKIGLRYKTRTGDRL
VSWKGPNDPSPGRFSYGGDPATFLQIFIWDGARPVYRNIPWTGFRVKSEHKYQQADPNAS
AIIAYMAVVNTDEEIYVTYSLSHGAARTRYVLTYSGEYRLESWSSRLLKWTVLAKWPPTD
CTRYGYCGSPPRGGRARTDV
Download sequence
Identical sequences M8BV88
EMT28950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]