SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT29385 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT29385
Domain Number 1 Region: 90-162,262-289
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000151
Family alpha-D-mannose-specific plant lectins 0.0098
Further Details:      
 
Weak hits

Sequence:  EMT29385
Domain Number - Region: 366-406
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00432
Family Anti-platelet protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT29385
Sequence length 499
Comment pep:novel supercontig:GCA_000347335.1:Scaffold8295:38924:40423:1 gene:F775_21463 transcript:EMT29385 description:"PAN domain-containing protein "
Sequence
MREGKPDPAIAVFLAALFIASAVPLIDGADGEEPVTQLSNGFTATHSADAPGRFEPVLYS
HNGVFAFGFLRVGSASLDLAVVHLPSSFPLWRATPARVADWSRPATLSFDSRLVLTVPGV
GQLWSTLNVVGDTVALLNSSDLVIRLFNRRGTPWRSFENPSDTLVLGQNFTMSSPPLISK
NRRFSLRFAKTYMALHMEFYGGRTRPMYWQYTAREAQPENATQPPVYGRLDSRGFFGLYL
LGGDQSVDMLAFDTFVRNLTGAFRRMTLDDDGNLRAYYWTEGSKAWTSDYKAINGPCELP
TPCGAYGLCVPGGAPKCQCLINSTASIAPPCRAEESTDLCGGGGGQLFDVVRRNRVSLAY
KEQLPFETYKTAAECEQSCAASCSCWGAVYNGGSGYCYLIDFPVETVVYEADDRKVGYFK
IRKAQQQSAAGRGMSPGVTAAVVVASLVLASLAVAGAYIGWKRWLRQRRAGGVGMEQELT
PGHYRDLKSMDSPNNSFKT
Download sequence
Identical sequences M8BWJ0
XP_020201290.1.58150 EMT29385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]