SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT32581 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT32581
Domain Number 1 Region: 304-380
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.77e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 479-570
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 3 Region: 112-179
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000162
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT32581
Sequence length 610
Comment pep:novel supercontig:GCA_000347335.1:Scaffold2392:22800:28609:1 gene:F775_09457 transcript:EMT32581 description:"Poly(RC)-binding protein 1 "
Sequence
MDGPAETPAVTEHEMSEIPNPTSGEQADASIEEQANPESDVPEQIKEEAENTSDEEPKGT
NNEESGNPSDEAQVTVKDEDMGDQNSEDQAIRSLEEPAEAEQLANVETEDKWPGWPGESV
FRVLVSAQKVGALIGRKGEFIKRMCDESKARIKILDGPPGVPERADRCASKPYNYMVAIG
LYNTLQLYSVLMCLLIFLFAGLSEVQNVCSKASSHIPFCIQNRRTVMVTRFSFVLICCKY
DFKSFEYWMKIPVKKLHILAAKDEPDALVPPAIDGLLRVHNRITDGLDSETDQAQRGAGP
AGPTRLLVPASQAGSLIGKQGATIKSIQDASKCALRILENVPPVALNDDRVVEIQGEPHD
VHKAVELIASHLRKFLVDRSVLPLFEMQMKVHSAPREQPMPAPQQWGPPLPWSHPPNIPP
SGPGYGGNPHFMPPRPQDNYYPPPDVHHVEKQPHYGISSYGRDANPTAAPTSGNQHLLHG
SSQISQKMQVPLSYADAVIGSAGANISYIRKHSGATISIQEGVPGEMTVEIAGSASQVQT
AQQLIKNFMAEASPQVPPPGPAPPSQPVDSGYNSYPPYGGPSYATPPGGAGPTPHNGGGY
GAHYPPNYGY
Download sequence
Identical sequences M8D7X1
EMT32581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]