SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Croqu1|47067|e_gw1.85.39.1 from Cronartium quercuum f. sp. fusiforme G11 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Croqu1|47067|e_gw1.85.39.1
Domain Number 1 Region: 53-176
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2e-19
Family Phosphorelay protein-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Croqu1|47067|e_gw1.85.39.1
Sequence length 193
Sequence
MSRVGPTSPLANPPALQQYSSRTPGEGYPFPRVQRQRTNYQQNTVTATPTAVIHIEAPPE
RLPARSSPPVIDMDVFQQLLAMEDDDVNEQTNCPFSFTKSLVEVYFEDGQGTVEQMECSL
SRADYKKVSQLAHFLRGSAASLGVCQVAATCEALELEISSCSSQDSNSLKEKVQAIKLGQ
LGAKQWFDKFYRQ
Download sequence
Identical sequences jgi|Croqu1|47067|e_gw1.85.39.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]