SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Croqu1|108234|estExt_Genemark1.C_800052 from Cronartium quercuum f. sp. fusiforme G11 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Croqu1|108234|estExt_Genemark1.C_800052
Domain Number 1 Region: 205-299
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000183
Family Thioltransferase 0.032
Further Details:      
 
Domain Number 2 Region: 435-536
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000749
Family UBX domain 0.0038
Further Details:      
 
Weak hits

Sequence:  jgi|Croqu1|108234|estExt_Genemark1.C_800052
Domain Number - Region: 650-681
Classification Level Classification E-value
Superfamily NAP-like 0.000314
Family NAP-like 0.0048
Further Details:      
 
Domain Number - Region: 14-55
Classification Level Classification E-value
Superfamily UBA-like 0.00214
Family TAP-C domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Croqu1|108234|estExt_Genemark1.C_800052
Sequence length 688
Sequence
MPSPLSSDPTVQPSGEDAVRSYLSITNTTNLAAARSALQTANGNLDLAIASYFDSTTSGQ
PTTSYAPLHVDDSGQSQSHALLSNRSNSPRGVRRAYEDARPRGSSKWFGFLLRIWTGPLR
FLAVPVSALADLTLTVVGMFARLLGLRLPSISFHWPRGRPARPTDPRTCAERWVRELEEE
TGAETSVYALASSSSTSSSARRPKRRLPDFLLVGYEEAVAQAKEQLKVLMVVFVSEEHDD
VAHFKRTTLMDDELLRTIEANHILVWGGDVRDRDACLAAHVLDVTTYPTIVFVALQTKRP
SVGSGFSHRPTLSSQPVMAISTRLEGIRATSSSAVVSAITGTVVPRTTALLMRLRAERDR
RAAERRLREEQDRAYAEAGRLDRERVLAKQAELAEKTRKEDEEARKLRAIVERREARKNE
EDTRKRWRAWAVKERMPVEPTEGTTGVVTVGFRLGNGRRVVRRFLGIEPIESLYVFVELE
SAGMPSVTTVGELPDGYKHEFRFKLSTAMPRRTIPLEAGLTVESFGGLDGANVNVEGNVV
GAESDDESDDEELDGDQKCILGAIAIGLRGDLLKPKSELLHISSPGRFKMEPQCHLETPQ
PPTNRRPKQAHLPIQSAQTYPPLLPLEGTTGIDTGYFAWPFEESLRAGVENTNQTRTIKK
AIPTKSFFTFFSPPTPPGQKVDKGVPIV
Download sequence
Identical sequences jgi|Croqu1|108234|estExt_Genemark1.C_800052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]