SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Croqu1|660974|fgenesh1_kg.107_#_24_#_Locus6615v1rpkm12.96 from Cronartium quercuum f. sp. fusiforme G11 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Croqu1|660974|fgenesh1_kg.107_#_24_#_Locus6615v1rpkm12.96
Domain Number 1 Region: 19-141
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-18
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0023
Further Details:      
 
Domain Number 2 Region: 180-283
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000497
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Croqu1|660974|fgenesh1_kg.107_#_24_#_Locus6615v1rpkm12.96
Sequence length 483
Sequence
MPSSSSFTAAEKATIKKTLPNSYHKILAAGFCRIYYAYPDPNRWSFTGLSGALVFGRSTS
NSSGQFWFKLVDVEGTRGTIWEHELYEDGSGHPGKGMFGYFQERTFWHTFQGDDCMIGFV
FSNEDEATTLFKKVNTRSKYINKYSRKSTAIESPNPPASPVVVSGKKKGGIDKSMISAPS
GFRRVAHMGYDSTNGFTTENVDPSWAQLLTNLSSMGFSKDDINKNEDFIREFVSQAGGVN
QILATPATQGRSGTGPPPPPVSRVPPPTVAAPITSKRVKPPAPPAPRRSGTLTNDPPDQH
QQSLAQTITRPPSNQAPSRPAPPILPSPATRSNAPPPAPPPPPPPLPASNAAPPPPPPPA
ALNTAPPPPPPPAALNTAPPPPPPPPATSAAPTSLPPVTGARADLLASIQGKGIHVLKKT
PQGATSEPQSNALNRSASSVTEGAGASGGTNLAASLAAALNKRKGTMGDDSDEEGGGSDD
EWD
Download sequence
Identical sequences jgi|Croqu1|660974|fgenesh1_kg.107_#_24_#_Locus6615v1rpkm12.96

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]