SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000000267 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000000267
Domain Number 1 Region: 123-317
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.45e-59
Family Astacin 0.0000888
Further Details:      
 
Domain Number 2 Region: 589-699
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-37
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 3 Region: 433-542
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-36
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 4 Region: 750-856
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-36
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 5 Region: 324-433
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-36
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 6 Region: 880-973
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-28
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 7 Region: 700-743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 544-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000152
Family EGF-type module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000000267   Gene: ENSAMEG00000000197   Transcript: ENSAMET00000000276
Sequence length 984
Comment pep:known_by_projection scaffold:ailMel1:GL192507.1:1789269:1906873:1 gene:ENSAMEG00000000197 transcript:ENSAMET00000000276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXXDYSALEGEEGAEQQLEHYHDPCKAAVFWGDIALDEEDLKLFHIDKARDWIKQSVEEG
GHSTGGLEEQPFESWENATATNISSEEARKDGEENAMLLLSPRTLDARAETFSPRVRRAT
TSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIERTDEESFIVFSYRT
CGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQ
PGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRRDDNGIRPTIGQR
VRLSQGDIAQARKLYKCPACGETLQDTTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVL
NFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLGRFCGDHVPEPLTSTDSRLWVEFRSSSSI
LGKGFFAVYEATCGGDINKDAGQIQSPNYPDDYRPSKECVWRITVSEGFHVGLTFQAFEI
ERHDSCAYDYLEIRDGPTEESTLIGHFCGYEKPEDVKSSSNRMWMKFVSDGSINKAGFAA
NFFKEVDECSWPDHGGCEQRCVNTLGSFKCACDPGYELAADKKTCGVACGGFITKLNGTI
TSPGWPKEYPTNKHCVWHVMAPAQYRISLQFEVFELEGNDVCKYDFVEVRSGLSPDARLH
GKFCGSEMPEVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTS
GSYLCRCRNGYRLHENGHDCKEAGCVHKISSAEGTLASPNWPDKYPSRRECTWNISSTAG
HRVKLTFNEFEIEQHQECAYDHLELYDGPDSLAPSLGRFCGSKKPDPVVASGSSLFLRFY
SDASVQRRGFQAVHSTECGGRLKAEVQTKELYSHAQFGDNNYPSQARCDWVIVAEDGYGV
ELIFRTFEVEEEADCGYDYMEAYDGYDGTAPRLGRFCGSGPLEEIYSAGDSVMIRFHTDG
TINKKGFHARYTSTKFQDALHMKK
Download sequence
Identical sequences G1L065
ENSAMEP00000000267 ENSAMEP00000000267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]