SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000000530 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000000530
Domain Number 1 Region: 368-627
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-36
Family YWTD domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 117-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 313-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 4 Region: 159-196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 203-238
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 242-277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 7 Region: 38-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000746
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 286-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.019
Further Details:      
 
Domain Number 9 Region: 83-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000353
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000694
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000000530
Domain Number - Region: 631-668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000177
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000000530   Gene: ENSAMEG00000000510   Transcript: ENSAMET00000000549
Sequence length 669
Comment pep:novel scaffold:ailMel1:GL192819.1:213978:222400:1 gene:ENSAMEG00000000510 transcript:ENSAMET00000000549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTPSSVPCRNGEGCVSENLCDGKPDCQDGSDEGDCSRFCNGPGVFQCLNRNQCIEEKYHC
DGAQQCSDGSDELGCWKPTEDCSLRCDNKTRCISKSWLCDGNPDCSDQRDEQGCIRAKCS
APEFQCENSQCISNSLHCDGNRDCQDHSDEDGCSVAWPLRCPSGEVKCQGSRECVPTEWL
CDRDFNCEDGTDEKDCDLEELRYGSWQWSCASGDQCVPDMWRCDSQRDCEDGSDEAGCNP
PEKCQSSEFQCRSHGCLDLRLVCDRKEDCANGSDEGGRCSSSTCSHTQCSHACYQSPHGQ
VCACAQGFELGSSGHVCKDVDECQKPGSQPCSQTCVNTQGSYSYTCHPGYLLEPDGHTCK
ATGTEPILLVAVQFNLLLYGLRSLKEDILTTVDKNVTIVSIDYDLVGQKVFWADLSAESV
EWMSMDAKKRGTVVKGVKSDCVAVDWIGRNLYWVDGTAGQISAIPLTAAWRGKSEHTIVL
DGDVTQPRSLAVDPLSGLMYWSEIGGEPQIEQAGMDGSSRKVLISQGLGWPTSIALDWLS
WKIFWSDDKFHCIGSANLDGTGVSMLQLTQIESPFLVAVFEDEVFWSEVKTRTVQHMKKM
TGKNRAVLIKRSQQPYGLKIMHEVLQPKSPNPCLDAGCSHLCLLSPRPKGSCHCPLGLLL
ADDGITCVP
Download sequence
Identical sequences G1L0X8
ENSAMEP00000000530 ENSAMEP00000000530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]