SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000000869 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000000869
Domain Number 1 Region: 810-918
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-22
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 2 Region: 3-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 280-401
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.05e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 626-786
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000615
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 5 Region: 242-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000014
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 131-279
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000000869   Gene: ENSAMEG00000000790   Transcript: ENSAMET00000000902
Sequence length 995
Comment pep:known_by_projection scaffold:ailMel1:GL192386.1:1497186:1517122:-1 gene:ENSAMEG00000000790 transcript:ENSAMET00000000902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHDCVN
IPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGSYECHCREGFFLSDNQ
HTCIQRPEEGMNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGC
QHTCDDTEQGPRCGCHVKFVLHTDGKTCIGGQNKAGEERKITTEQPTYLHLELKKRLGTE
TCAVNNGGCDSKCHDAATGVHCSCPVGFMLQPDRKTCKDIDECRLNNGGCDHICRNTVGS
FECSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCHHGYLLYGVTHCGDV
DECSINRGGCRFGCINTPGSYQCTCPAGQGRLHWNGKDCTEPVKCQSSPGASKAMLTCNR
SGKKDTCALTCPSRARFSPESENGFTVSCGTPSPRAAPARAGHPGNSTNANHCHEAAVLS
VKQRASFKIKDAKCRLHLRNKGKMEEASRTLGQGGAPCSDCQVTFIHLKCDSSRKGKGRR
ARTPPGKEVTRLTLELEAEVRAEETTATCGLPCLRQRMERRLKGSLKMLRKSINQDRFLL
RLAGLDYELAHKLGPGAGERAELAEACRPGQHRTGAKCVSCPQGTYYHGQTEQCVPCPAG
TFQEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCSPGQYSVDGFKPCQPCPRGTYQPEG
GRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNF
CTRCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPP
KRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINF
KTSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAH
PQNYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences G1L1W6
ENSAMEP00000000869 ENSAMEP00000000869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]