SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000000940 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000000940
Domain Number 1 Region: 72-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-19
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 2 Region: 8-69
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000000940   Gene: ENSAMEG00000000912   Transcript: ENSAMET00000000977
Sequence length 137
Comment pep:novel scaffold:ailMel1:GL192519.1:1999777:2014098:1 gene:ENSAMEG00000000912 transcript:ENSAMET00000000977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTVLPSHTCGNPGRLPNGIQQGSTFNLGDKVRYSCNPGFFLEGHAVLTCHAGSENSATWD
FPLPSCRADDACGGTLRGQSGIISSPHFPSEYHNNADCTWTVLAELGDTIALVFIDFQLE
DGYDFLEVTGTEGSSLW
Download sequence
Identical sequences G1L235
ENSAMEP00000000940 ENSAMEP00000000940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]