SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000000949 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000000949
Domain Number 1 Region: 404-698
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.92e-81
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 27-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-33
Family Spermadhesin, CUB domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 187-299
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-31
Family Spermadhesin, CUB domain 0.0000262
Further Details:      
 
Domain Number 4 Region: 303-373
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 137-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000918
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000000949   Gene: ENSAMEG00000000843   Transcript: ENSAMET00000000986
Sequence length 702
Comment pep:known_by_projection scaffold:ailMel1:GL192402.1:2585836:2639430:1 gene:ENSAMEG00000000843 transcript:ENSAMET00000000986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FMSFRWLLLCHALCLSLLKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPEGFR
IKLYFMHFNLESSYLCEYDYVKVETEEQVLATFCGRETTDTEQTPGQEVVFSPGSFMSIT
FRSDFSNEERFTGFDAHYMAVDVDECTEREDEELSCDHYCHNYIGGYYCSCRFGYLLHTD
NRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECFYTIELEEGFMVSLQFEDIFDIEDH
PEVSCPYDYIKIKAGPKVLGPFCGERAPEPINTQSHSVQILFRSDNSGENRGWRLSYRAT
GNECPEPEPPVHGKIEPQQTTYSFKDQVLISCDTGYKVLKDNVEMDTFQIECLKDGTWSN
RIPTCKIADCGAPAELKHGLITFSTRNNLTTYKSEIQYSCQQPYYKMLHNITGIYTCSAQ
GVWMNEVLGRSQPTCLPVCGVPKFSRKLMARIFNGHPAQKGTTPWIAMLSYPNEQPFCGG
SLLGSSWIVTAAHCLHQSLDPDYPALHDSDLLRPSDFKIIMGKHWRRRSDGNEQHLRVKR
VFLHPLYDPNTFENDVALVELLESAVLSDFVMPICLPQGPPQEGDVVVVSGWGKQFLQRF
PETLMEIEIPIVDHRTCQEAYAPLKRKVTRDMICAGEKEGGKDACAGDSGGPMVTLDKER
GHWYLVGTVSWGEDCGKKDRYGVYSYIYHNKDWIQRVTRMRD
Download sequence
Identical sequences G1L244
ENSAMEP00000000949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]