SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000000952 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000000952
Domain Number 1 Region: 401-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.23e-77
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-33
Family Spermadhesin, CUB domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-31
Family Spermadhesin, CUB domain 0.0000262
Further Details:      
 
Domain Number 4 Region: 300-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000958
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000000952   Gene: ENSAMEG00000000843   Transcript: ENSAMET00000000989
Sequence length 728
Comment pep:known_by_projection scaffold:ailMel1:GL192402.1:2585845:2626684:1 gene:ENSAMEG00000000843 transcript:ENSAMET00000000989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRWLLLCHALCLSLLKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPEGFRIKL
YFMHFNLESSYLCEYDYVKVETEEQVLATFCGRETTDTEQTPGQEVVFSPGSFMSITFRS
DFSNEERFTGFDAHYMAVDVDECTEREDEELSCDHYCHNYIGGYYCSCRFGYLLHTDNRT
CRVECSDNLFTQRTGVITSPDFPNPYPKSSECFYTIELEEGFMVSLQFEDIFDIEDHPEV
SCPYDYIKIKAGPKVLGPFCGERAPEPINTQSHSVQILFRSDNSGENRGWRLSYRATGNE
CPEPEPPVHGKIEPQQTTYSFKDQVLISCDTGYKVLKDNVEMDTFQIECLKDGTWSNRIP
TCKIADCGAPAELKHGLITFSTRNNLTTYKSEIQYSCQQPYYKMLHNITGIYTCSAQGVW
MNEVLGRSQPTCLPVCGQPSRSLPNLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKW
FGSGALLSESWILTAAHVLRSQRRDNTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAAQVV
LHPDFNIQNYNHDIALVRLREPVPLGPHVMPICLPSPEPEGPEPHMLGLVAGWGISNPNV
TVDEIISSGTRTLSDVLQYVKLPVVPYAECKTSYESRSGNYSVTENMFCAGYYEGGKDTC
LGDSGGAFVILDDLSQRWVALGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGSPQG
LGELQVER
Download sequence
Identical sequences G1L247
ENSAMEP00000000952 ENSAMEP00000000952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]