SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000000974 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAMEP00000000974
Domain Number - Region: 2-144
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000706
Family SMI1/KNR4-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000000974   Gene: ENSAMEG00000000934   Transcript: ENSAMET00000001011
Sequence length 240
Comment pep:novel scaffold:ailMel1:GL193173.1:879734:902628:-1 gene:ENSAMEG00000000934 transcript:ENSAMET00000001011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNNCVLPEDVKNFYLMTNGFHMTWSVKLDEHTIPLGSMAINSISKLTQLNQSSVYSLPNA
PTLADLEDDALEDSENQPEKPHFDSRSVIFELDPCNGNGKVCLVYKRGKPALAQDTEIWF
LDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFNMYKPITYNTDLL
AEETDSFVNKLDPSRVFKSKNKTLLPKKKGPAQPAGGQKGPPGPPSTSKSSSSPGNPVRK
Download sequence
Identical sequences D2HQD9
ENSAMEP00000000974 ENSAMEP00000000974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]