SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000001463 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000001463
Domain Number 1 Region: 616-871
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-56
Family YWTD domain 0.00000515
Further Details:      
 
Domain Number 2 Region: 4-264
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-54
Family YWTD domain 0.00000166
Further Details:      
 
Domain Number 3 Region: 315-545
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-50
Family YWTD domain 0.00000259
Further Details:      
 
Domain Number 4 Region: 917-1177
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-38
Family YWTD domain 0.0000684
Further Details:      
 
Domain Number 5 Region: 1303-1341
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1228-1266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 7 Region: 573-611,865-914
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000314
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 270-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1185-1237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000995
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000001463
Domain Number - Region: 1268-1290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00877
Family LDL receptor-like module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000001463   Gene: ENSAMEG00000001320   Transcript: ENSAMET00000001519
Sequence length 1586
Comment pep:known_by_projection scaffold:ailMel1:GL192819.1:1233786:1304977:1 gene:ENSAMEG00000001320 transcript:ENSAMET00000001519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASPLLLFANRRDVRLVDAGGVKLESTVVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQ
TYLNQTGVAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQD
LDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKL
YWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGE
KRKEILSALYSPMDIQVLSSERQPYFHTRCAEDNGGCSHLCLLSPREPFYTCACPTGVQL
QDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYW
TDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS
RKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECAHLDGQERHILVNTSLGWPNGLA
LDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIE
RVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADKNGGCSHLCFFTPRATKCGCPI
GLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHI
YWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWVGKNLYWADTGTNRIEVARLDG
QFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDL
TIDYVDQRLYWTDLDTNMIESSDMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIE
RADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCA
SHYTLDPTSRNCSPPTAFLLFSQKCAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDK
FIYWVDGRQNIKRAKDDGTQPFVLTSPSQSQNPDRQPHDLSIDIYSRTLFWTCEATNTIN
VHRLNGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTT
GLIRPVALVVDNRLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGKHLYW
IDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEDVSLEEFSAHPCARDNGGCSHICI
AKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQ
SDEEGCPVCSAAQFPCARGQCVDLRLRCDXXXXXXSLNARLLLAAVCLPNQFRCASGQCV
LIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQR
VVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGSSQHGPFTGISCGKSMMSSVSLMGGRGG
VPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVDVFYSSNIPTTTRPYR
PYIIRGMAPPTTPCSTDVCDSDYSANRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDS
CPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences G1L3K3
ENSAMEP00000001463 ENSAMEP00000001463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]