SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000001487 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000001487
Domain Number 1 Region: 308-563
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-56
Family YWTD domain 0.00000515
Further Details:      
 
Domain Number 2 Region: 7-237
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-50
Family YWTD domain 0.00000259
Further Details:      
 
Domain Number 3 Region: 609-869
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-38
Family YWTD domain 0.0000684
Further Details:      
 
Domain Number 4 Region: 997-1033
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 920-958
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 6 Region: 265-303,557-606
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 877-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000698
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000001487
Domain Number - Region: 960-992
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00183
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000001487   Gene: ENSAMEG00000001320   Transcript: ENSAMET00000001544
Sequence length 1278
Comment pep:known_by_projection scaffold:ailMel1:GL192819.1:1260356:1304980:1 gene:ENSAMEG00000001320 transcript:ENSAMET00000001544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAI
RRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSED
LDEPRAIVLHPVMGLMYWTDWGENPKIECAHLDGQERHILVNTSLGWPNGLALDLQEGKL
YWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKAS
RDVIIDQLPDLMGLKAVNVAKVVGTNPCADKNGGCSHLCFFTPRATKCGCPIGLELLSDM
KTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLK
TISRAFMNGSSVEHVIEFGLDYPEGMAVDWVGKNLYWADTGTNRIEVARLDGQFRQVLVW
RDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYVDQR
LYWTDLDTNMIESSDMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGR
NRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPT
SRNCSPPTAFLLFSQKCAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGR
QNIKRAKDDGTQPFVLTSPSQSQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLNGDA
MGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVAL
VVDNRLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGKHLYWIDRQQQMI
ERVEKTTGDKRTRVQGRVAHLTGIHAVEDVSLEEFSAHPCARDNGGCSHICIAKGDGTPR
CSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPV
CSAAQFPCARGQCVDLRLRCVWERQCGRKADSKSLSSVCLPNQFRCASGQCVLIKQQCDS
FPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAG
ANGPFPHEYVSGTPHVPLNFIAPGSSQHGPFTGISCGKSMMSSVSLMGGRGGVPLYDRNH
VTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVDVFYSSNIPTTTRPYRPYIIRGMA
PPTTPCSTDVCDSDYSANRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATE
RSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences G1L3M7
ENSAMEP00000001487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]