SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000001924 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000001924
Domain Number 1 Region: 53-174
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000628
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000001924   Gene: ENSAMEG00000001817   Transcript: ENSAMET00000002001
Sequence length 323
Comment pep:known_by_projection scaffold:ailMel1:GL193343.1:369290:381030:1 gene:ENSAMEG00000001817 transcript:ENSAMET00000002001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSFKLQCHFILIFLMALRGENRYLELREAADHDPFLLFGANLKRELAGEPVYRRALRC
LDMLSLPGQFTFTADRPQLHCAAFLIAEPEEFITIHYDLVSIDCQRGDFLKKVFDGWILK
GEKFPSSQDHPLATTERYIDFCDSGLSRRSIRSSQNVAMIFFRVHEPGNGFTFTIKTDPN
LFPCNAISQTPSGRFTLVVPHLRRNCSFSIIYPVVIKISDLTLGHLHGRQLKNPSAGCGG
IGDFVELLGGPGLDPSKMMPLADLCYSFHGPAQMKIGCDNTVVRMVSSGKHMNRVTFEYR
QLEPYELENPSGNSIQEICLSSV
Download sequence
Identical sequences G1L4W4
ENSAMEP00000001924 ENSAMEP00000001924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]