SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000002013 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000002013
Domain Number 1 Region: 51-152
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.23e-16
Family SAM (sterile alpha motif) domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000002013   Gene: ENSAMEG00000001909   Transcript: ENSAMET00000002094
Sequence length 172
Comment pep:known_by_projection scaffold:ailMel1:GL193319.1:519959:521098:-1 gene:ENSAMEG00000001909 transcript:ENSAMET00000002094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATAHFSFCRTLLEHTVSAESIPCHLPRTPGTSLTWHDSRSQRAAGGRPVKLLQQPGTEAP
QGRLYSDHYGLYHTSPSLGGLARPVVLWSQQDVCKWLKKYCPHNYLVYVEAFSQHAITGR
ALLRLNGEKLQRMGLAQEAQRQEVLQQVLRLQVREEGRSLQLLSQASFGNTS
Download sequence
Identical sequences G1L553
ENSAMEP00000002013 ENSAMEP00000002013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]