SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000002120 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000002120
Domain Number 1 Region: 284-536
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.18e-88
Family Eukaryotic proteases 0.0000541
Further Details:      
 
Domain Number 2 Region: 189-296
Classification Level Classification E-value
Superfamily SRCR-like 8.76e-19
Family Hepsin, N-terminal domain 0.094
Further Details:      
 
Domain Number 3 Region: 155-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000002120   Gene: ENSAMEG00000001989   Transcript: ENSAMET00000002210
Sequence length 540
Comment pep:known_by_projection scaffold:ailMel1:GL192919.1:513719:534948:1 gene:ENSAMEG00000001989 transcript:ENSAMET00000002210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQASGLRLLLPLLCGGLGTQRARILSSLTRSCPHEPGKGCVYGKLQTLGVSVPSLAPSAF
FGCGHSAKEAVAQAEPNPRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISPVAPDADA
VAAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIDLTARCDGV
PDCRDGEDEYRCVRVSGQNAVLQVFTAAAWRTVCSDDWKGHHANVACAQLGFPSYVSADT
LGVDLLEKQLQEDFVSINHLLPDDKVTALQHSVYVREACASGRVVTLKCTVCGLRMGYSS
RIVGGNVSSLMQWPWQASLQFQGYHLCGGSVITPVWIVTAAHCVYDLYVPKSWTIQVGLV
SLLDSPAPSHLVEKIIYHSKYKPKRLGHDIALMKLAGPLTFSETIQPVCLPNSEENFPDG
KLCWTSGWGAIEDGDAGDASPILNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLKGGV
DSCQGDSGGPLVCQERRVWKLVGATSFGIGCADVNKPGVYTRVTSFLDWIHEQMERDLRT
Download sequence
Identical sequences G1L5F9
ENSAMEP00000002120 ENSAMEP00000002120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]