SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000002377 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000002377
Domain Number 1 Region: 568-829
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-89
Family Eukaryotic proteases 0.0000000269
Further Details:      
 
Domain Number 2 Region: 314-422
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-30
Family Spermadhesin, CUB domain 0.00083
Further Details:      
 
Domain Number 3 Region: 188-307
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-21
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 4 Region: 62-148
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000445
Family SEA domain 0.0067
Further Details:      
 
Domain Number 5 Region: 463-500
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 499-534
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 428-463
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 8 Region: 540-579
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000121
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000002377   Gene: ENSAMEG00000002200   Transcript: ENSAMET00000002478
Sequence length 830
Comment pep:known_by_projection scaffold:ailMel1:GL192347.1:3310010:3327170:-1 gene:ENSAMEG00000002200 transcript:ENSAMET00000002478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQNMNGMEEGVEFLPVNNTKKVEKRGPKRWVVLVAVLVGLLLLSVVACVLVWHFQYRNVR
VQKVFNGYLRITNEKFLDAYENSNSTEFANLANKVKEALRLLYRGVPSLGPYHKESAVTA
FSEGSIIAYYWSEFSIPTYLVEEAERAMAEERVVTLPPRARTFNSFVLTSVVAFPTDPRT
VQTAQDNSCSFALHARSGELTRFTTPGFPDSPYPAQARCQWTLRGDADLVLSLTFHSFDV
ASCDDRGSDVVMVYDTLSPVEPRAVVQLCGTYPPSYNLTFLSSQNVLLVTLITNTERRHP
GFEATFFQLPKLSSCGGYLRGPYGTFSSPYYPGHYPPNMNCTWDIEVPNNQHVKVLFKLF
YLLEPDIPPGSCPKDYVEVNGEKYCGERPQFVVTSNSNKITVRFHSDQSYTDTGFLAEYL
SFDSSDPCPGKFMCNTGRCIQNELRCDGWADCTDYSDELNCQCNATYQFTCKNKFCKPLF
WVCDSVNDCGDNSDELECSCPAQTFRCGNGKCLPQNQQCDGKDNCGDGSDEATCDLARTV
ACTTYTYRCHNGLCLSKSNPECDGKEDCSDGSDEKDCDCGLRSFTRQSRVVGGTNADEGE
WPWQVSLHVQGQGHVCGASIISPNWMVSAAHCFIDDRGFRYSDHTKWTAFLGLHDQSKRS
ATGVQELGLKRIISHPFFNDFTFDYDIALLELETPAEYSSTVRRICLPESSHTFPTGKAI
WVTGWGHTQEGGSGALVLQKGEIRVINQTTCESLLPQQITPRMMCVGYLSGGVDACQGDS
GGPLSSVEADGRIFQAGVVSWGDGCAQRDKPGVYTRLSVFRDWIKEQTGV
Download sequence
Identical sequences G1L662
ENSAMEP00000002377 ENSAMEP00000002377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]