SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000002423 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000002423
Domain Number 1 Region: 112-391
Classification Level Classification E-value
Superfamily L domain-like 7.48e-53
Family Ngr ectodomain-like 0.0076
Further Details:      
 
Domain Number 2 Region: 413-721
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.23e-43
Family Rhodopsin-like 0.00066
Further Details:      
 
Domain Number 3 Region: 37-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000002423   Gene: ENSAMEG00000002276   Transcript: ENSAMET00000002525
Sequence length 769
Comment pep:known_by_projection scaffold:ailMel1:GL192846.1:389368:454461:1 gene:ENSAMEG00000002276 transcript:ENSAMET00000002525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLMFSMSSSSSTRPTLILITFSPRSSSVVPASGQDVKCSLGYFPCGNTTKCLPQLLHCNG
VDDCGNQADEDNCGDNNGWPLQFDKYIAGYHRMTSPYPFETQTSECLVGSVPMQCLCRGL
EVDCDETNLRAVPSVSSNVTIMSLQWNLIRKLPPDGFKKYHNLQKLCLQNNRIRSIPIYA
FRGLHSLTKLYLSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLAL
MNNVLTHLPDKPLCQHMPRLHWLDFEGNHIHNLRNFTFISCSNLTVLVMRKNKINHLNEN
TFAPLQKLDELDLGSNKIENFPPQVFKDLKELSQLNLSYNPIQKIQADQFDYLVKLRSLS
LEGIEISNIQQRMFRPLTNLSHIYFKKFQYCAYAPHVRSCKPNTDGISSLENLLANIIQR
VFVWVVSAVTCFGNIFVICMRPYIRSENKLHAMSIISLCCADCLMGIYLFLIGAFDLKFR
GEYNKHAQLWMESIHCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCLRPRKCRTI
TVLVLIWIAGFMVAFIPLTNKEFFRNYYGNNGVCFPLHSEDTGSTGAQIYSVTIFLGVNL
VAFIIIVFSYGSMFYSVHQSTITATEIRNQVKKEMILAKRFFFIVFTDALCWIPIFVLKF
LSLLQVEIPGTITSWVVIFILPINSALNPILYTLTTRPFKEMIHQFWYNYRQRRSIDSKG
SQKTYAPSFIWVEMWPLQEMPPELIKPALFTDPCELSLISQSTRLNSYS
Download sequence
Identical sequences G1L6A8
ENSAMEP00000002423 ENSAMEP00000002423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]