SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000002601 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000002601
Domain Number 1 Region: 24-80
Classification Level Classification E-value
Superfamily RING/U-box 1.67e-16
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000002601
Domain Number - Region: 110-166
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0373
Family SMI1/KNR4-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000002601   Gene: ENSAMEG00000002477   Transcript: ENSAMET00000002715
Sequence length 182
Comment pep:novel scaffold:ailMel1:GL194271.1:196614:201141:1 gene:ENSAMEG00000002477 transcript:ENSAMET00000002715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPE
RQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF
HFSFGVGAFPFGFFTTVFNTHEPFRRGTGTAFYFPSFSHYLIGYTSHEFRGRIDNFWLLR
SL
Download sequence
Identical sequences G1L6T5
ENSAMEP00000002601 ENSAMEP00000002602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]