SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003337 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003337
Domain Number 1 Region: 275-428
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000603
Further Details:      
 
Domain Number 2 Region: 431-596
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.2e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000175
Further Details:      
 
Domain Number 3 Region: 148-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-34
Family Spermadhesin, CUB domain 0.000019
Further Details:      
 
Domain Number 4 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 642-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.33e-27
Family MAM domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003337   Gene: ENSAMEG00000003086   Transcript: ENSAMET00000003469
Sequence length 931
Comment pep:known_by_projection scaffold:ailMel1:GL192762.1:940398:1050164:-1 gene:ENSAMEG00000003086 transcript:ENSAMET00000003469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMFPFTWVFLALYFSGHEVRGQPDSPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLVHQEPPENFQCNVPLGMESGRIANEQITASSTYS
DERWTPQQSRLHGDDNGWTPNLDSSKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHTPLLTRFVRVRPQTWHSGIAL
RLELFGCRVTDAPCSNMLGMLSGLIPDSQISASSTREYLWSPSAARLVSSRSGWFPRTPQ
AQPGEEWLQVDLGVPKTVKGIIIQGARGGDSITAVEARAFVRKFKVSYSLNGRDWEYIQD
PRTQQPKLFEGNMHYDTPDIRRFDPVPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPIDEEATECGENCSFEDDKDLQLPSGFNCNFDFPEEPCGWMYD
HAKWVRSTWTSSSSPNDRVFPDDRNFLRLQSDGRREGQYARLISPPVHLPRSPVCMEFQY
QATGGHGVALQVVREASQESKLLWVIREDQGNEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEIAVDDIRISTDVPLESCMEPITAFAGENFKVDIPEIHGREGYEDEIDDEYEVDWSNS
SSPTSGSGAPSADKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSR
SCTTLENYNFELYDGLKHKVKMNHQKCCSEA
Download sequence
Identical sequences G1L8W8
ENSAMEP00000003337 ENSAMEP00000003337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]