SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003392 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003392
Domain Number 1 Region: 80-151
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.24e-19
Family Skp1 dimerisation domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 5-56
Classification Level Classification E-value
Superfamily POZ domain 0.000000051
Family BTB/POZ domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003392   Gene: ENSAMEG00000003220   Transcript: ENSAMET00000003527
Sequence length 157
Comment pep:novel scaffold:ailMel1:GL192367.1:876573:877642:-1 gene:ENSAMEG00000003220 transcript:ENSAMET00000003527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPSVKRQSSDGEVFEADVEIAKQSVTIATVVGDLGMDEGGGDDPAPTPNIKATIFKNSHL
VPPPPPPEDDENKAKRTDDIPVWDQEFLKANQGTLCELILAANYLEILSVLEVTRKMVAG
TIKGTTPEEIRNTFNIKKDFEAQAAQVCKEEQWCEKK
Download sequence
Identical sequences G1L923
ENSAMEP00000003392 ENSAMEP00000003392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]