SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003419 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003419
Domain Number 1 Region: 3007-3378
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.76e-102
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 2014-2382
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.31e-100
Family Regulator of chromosome condensation RCC1 0.0013
Further Details:      
 
Domain Number 3 Region: 3515-3846
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.4e-88
Family Hect, E3 ligase catalytic domain 0.0000385
Further Details:      
 
Domain Number 4 Region: 1785-1967
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.59e-33
Family APC10-like 0.0064
Further Details:      
 
Domain Number 5 Region: 1610-1687
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.93e-30
Family CPH domain 0.00065
Further Details:      
 
Domain Number 6 Region: 917-983
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.09e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 7 Region: 260-344
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000471
Family Cytochrome b5 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000003419
Domain Number - Region: 1511-1562
Classification Level Classification E-value
Superfamily UBA-like 0.00035
Family UBA domain 0.008
Further Details:      
 
Domain Number - Region: 2677-2763
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00916
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003419   Gene: ENSAMEG00000003194   Transcript: ENSAMET00000003555
Sequence length 3892
Comment pep:known_by_projection scaffold:ailMel1:GL194104.1:147093:290486:1 gene:ENSAMEG00000003194 transcript:ENSAMET00000003555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVFLFYELQDIEAKKEAQKEKEIDEQEANASTFHRSRTPLDKDLINTGIYESSGKQCLPL
VQLIQQLLRNIASQTVARLKDVARRISSCLDFEQHSRERTASLDLLLRFQRLLISKLYPG
ESIGQTSDISSPELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAEVACIVEGD
FTDVGVLLPELVVSIVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDHEEL
AWPGIMESFFTGQNCRNNEEVTQIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGN
SILAQFAGEDPVVALEAALQFEDTRESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTE
RNLGLLLGLHASYLAMSTPLSPVEIECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSS
PGGTPASKSRLCSHRRALGDHSQAFLQAIADNNIQDHNVKDFLCQIERYCRQCHLTTPIT
FPPEHPVEEVGRLLLCCLLKHEDLGHVALSLVHAGTLGIEQVKHRTLPKSVVDVCRVVYQ
AKCSLIKTHQEQGRSYKEVCAPVIERLRFLFNELRPAVCNDLSITSKFKLLSSLPRWRRI
AQKIIRERRKKRVPKKPESTDDEEKIGNEESDLEEACILPHSPINVDKRPITIKSPKDKW
QPLLSTVTGVHKYKWLKQNVQGLYPQSALLSTIAEFALKEEPVDVEKMRKCLLKQLERAE
VRLEGIDTILKLATKNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRM
LLEVTFGKLYAWAVQNIRNVLMDANAKFKELGIQPVPLQTITNENPSGPSLGTTPQARFL
LVMLSMLTLQHGANNLNLLLNSGTLALTQTALRLIGPSCDNVEEDMNASARGASATVLEE
TRKEMAPVQLPVSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRV
QWDTGSTNSYRMGKEGKYDLKLAELPASTQPSAEDSDTEDDSEAEQIERNIHPTAMMLTS
TVNLLQTLCLSAGVHAEIMQSEATKTLCGLLRMLVESGTTDKTSSPNRLVCREQHRSWCT
LGFVRSIALTPHMCAALSSPQWIALLMKVVEGHAPFTAASLQRQILAVHLLQAVLPSWDK
TERARDMKCLVEKLFGFLGSLLATCSSDIPFLRESTLRRRRARPQASLTATHSSTLAEEV
VALLRTLHSLGQWNGLINKYINSQLHSVTCSCTGKPSEGAQLEDYFPDSENPEVGGLMAV
LAVIGGIDGRLRLGGQVMHDEFGEGTVTRITPKGRITVQFSDMRMCRVCPLNQLKPLPAV
AFSVTNLPFTEPMLSVWAQLVNLAGSKLEKHKVKKSPKQGFAGQVDLDLLRCQQLKLYIL
KAGRALLSHQDQLRQILSQPAVQEVTAAHTDSDDGAAASPDLGDMSPEGPQPPMILLQQL
LASATQPSPVKAIFDKQELEAAALAVCQYLAVESTHPSSPVFEDCSSSEATTPVPVQHVR
PVRAKKRKQSPAPALPIVVQLMEMGFPRRNIEFALKSLTGASGNAAGLPGVEALVGWLLD
HADVQVTDLSDADTGSEECSDEEVVEDVDDSAYAVSTGAVVTESQTYKKRADFLSNDDYA
VYVRENIQVGMMVRCCRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIH
VELIGYPPPSSPSHIKIGDKVRVKASVTTPKYKWGSVTHQSVGVVKAFSANGKDVIVDFP
QQSHWTGLLSEMELVPSVHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTRKHNTR
HTFGRINEPGQSAIFCGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDG
SEPCWQSSGSQGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELK
TININPTDTTVSLLNDCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVP
FLASDNEEEEDEKGNSGSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPS
FSETLSALNVVQVAGGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSS
YVVKKVAVHSGGRHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDI
ACGSSHSAALTSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQ
TLALTDEGLVFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSG
VVWTWGKGDYFRLGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDAGQVYAWGDN
DHGQQGNGTTTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTAR
DPLGASYLGVPSDADSSAASNKISGANNSKPNRPSLAKILLSLDGNLAKQQALSHILTAL
QILYARDAVVGALMPAGMIAPVECPSFSSSAPPSDISAMASPVNGEECVLAIDIEDRLSP
NPWQEKRGEMISSEDAVTPSAVTPSASSASSRPFIPVTDDPGAASIIAETMTKTKEDVES
QNKASGPEPQSLDEFTSLLVADDTRVMVDLLKLSVCSRAGDKGRDVLSAVLSGMGTAYPQ
VADMLLELCVTELEDVATDSQSGRLSSQPVVVESSHPYTDDTSSSGTVKIPGAEGLRVEF
DRQCSTERRHDPLTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGW
RFTVYPIMPAAGPKDLLSDRCVLSCPSMDLVTCLLDFRLNLTSNRSIVPRLAASLAACAQ
LSALAASHRMWALQRLRKLLTTEFGQSININRLLGDNDGEARALSFTGSALAALVKGLPE
ALQRQFEYEDPIVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASR
VAVALDKRTPLPRLFLDEVAKKIRELMADSEHMDVLHESHDIFKREQDEQLVQWMNRRPD
DWTLSAGGSGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTA
DGKLYATGYGAGGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYS
WGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGR
LGHSDSEDQLKPKLVEALQGHRVVDVACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGS
DGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQ
VQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKK
VNRVACGSAHTLAWSTSKPASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHISELFCP
CIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNR
IQVKRSRSKGGLAGPDGTKSVFGQMCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGY
SESIAEICEELQNGLTPLLIVTPNGRDESGANRDCYLFSPAARAPVHTNMFRFLGVLLGI
AIRTGSPLSLNLAEPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLP
FTVPSASGQDIQLSSKYTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLL
SLFTGYELETMVCGSPDIPLHLLKSVATYKGIEPSASLIQWFWEVMESFSNTERSLFLRF
VWGRTRLPRTIADFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLK
YAIHFCKSIDTDDYARIALTGEPAADDSSDDSENEDVDSFASDSTQDYLTGH
Download sequence
Identical sequences G1L948
ENSAMEP00000003419 ENSAMEP00000003419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]