SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003488 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003488
Domain Number 1 Region: 766-1014
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.31e-78
Family Eukaryotic proteases 0.0000556
Further Details:      
 
Domain Number 2 Region: 432-553
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.62e-35
Family Frizzled cysteine-rich domain 0.00015
Further Details:      
 
Domain Number 3 Region: 116-229
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.22e-29
Family Frizzled cysteine-rich domain 0.00076
Further Details:      
 
Domain Number 4 Region: 558-595
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 321-359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 633-672
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 248-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 284-322
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 363-403
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000942
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 599-631
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 11 Region: 691-769
Classification Level Classification E-value
Superfamily SRCR-like 0.0000523
Family Scavenger receptor cysteine-rich (SRCR) domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003488   Gene: ENSAMEG00000003272   Transcript: ENSAMET00000003625
Sequence length 1021
Comment pep:known_by_projection scaffold:ailMel1:GL192508.1:893466:1085318:1 gene:ENSAMEG00000003272 transcript:ENSAMET00000003625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGAVDNNMGDGCSQKLATANILRFLLLVLIPCICALIVLLVILLSFVGTLKKAYFKSNG
SEPLVTDGEVQVSDIILTNTICNKSTVTSAPHPSQHIPAWTTDASLPGDQNHKNTSACTN
ITHSQCQMLPYQTTLTPLFPIVQNMQVEKFLKFFMYLHRLSCYQHIMLFGCSLAFPECVR
DGDDSHGLLPCRSFCEAAKEGCDSVLGMVNASWPDFLTCSQFRNETESNNVSRICFSPQQ
EKGKQSLCGGGDSFLCASGLCVPGKLQCNGHNDCDDWSDEAHCNCSENMFHCLTGKCLNY
SLVCDGYDDCGDLSDEQDCDCNPTKEHRCGDGRCIAIEWVCDGDHDCVDKSDEVNCSCHS
QGLAECRSGQCIPSTFQCDGDEDCRDGTDEENCSQSQTPCQEGDQRCLYSSCLDPCGGGA
LCDPNLSLNNCSQCEPITLELCMNLPYNHTNYPNYLGHRTQKEASISWESSLFPALVQTN
CYKYLMFFACTILVPKCDVNTSQRIPPCRALCQHSKEHCESVLGIVGLQWPEDTDCSQFP
EENSDNQTCLMPDEAVEECSPRHFKCGSGRCVLASRRCDGQADCDDDSDEENCGCKERDL
WECPSNKQCLKHTVICDGFPDCPDGMDEKNCSFCHDDELECTNHECVSRERWCDGEADCS
DSSDEWDCVTLSKNVSSSSFLMAHRSAVEHHVCADGWQETLSQLACKQMGLGEPSVTELV
QEQEQDQLWLTLHSSWESLNGTTLHELLVKGQACHSRSKISLLCTKQDCGRRPAARMNKR
ILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGIN
NLDHPSTFMQTRLVKTIVLHPRYSRAVVDYDISVVELSEDVDETSYVRPVCLPGSGQALE
PDTYCYITGWGHMGNKMPFKLQEGEVRIISLEQCQSYFDMKTITARMICAGYESGTVDSC
MGDSGGPLVCERPGGQWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIERQIYIHTFLL
N
Download sequence
Identical sequences G1L9B6
ENSAMEP00000003488 ENSAMEP00000003488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]