SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003497 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003497
Domain Number 1 Region: 133-327
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.63e-59
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 754-865
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-37
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 3 Region: 450-552
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-36
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 334-443
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-36
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 5 Region: 890-983
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-30
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 6 Region: 599-710
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-29
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 7 Region: 554-597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000829
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 712-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000192
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003497   Gene: ENSAMEG00000003243   Transcript: ENSAMET00000003634
Sequence length 994
Comment pep:known_by_projection scaffold:ailMel1:GL192401.1:1559382:1602052:-1 gene:ENSAMEG00000003243 transcript:ENSAMET00000003634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSSHTPSVLLLVGPLLLWLLLLPRPGRPLDLADYTYDLGEEDDSEPVNERGVSPCPCAS
AFLGDIALDEEDLRAFQEQQAVDLRQRATHRASIKTAGNSSTFDCQSTNGQLQRRSCGRW
RGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDE
DSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDR
HVSIIRENIQPGQEYNFLKMELQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEV
NGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRI
SVTPGEKIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDSRL
WVEFRSSSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCVWRIQVSEGFH
VGLTFQSFEIERHDSCAYDYLEVRDGHSESSALIGRYCGYEKPDDIKSTSSRLWLKFVSD
GSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACG
GFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVSTYWAEETQ
RSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDK
ACQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKE
CTWAISSTPGHRVKLTFVEMDIESQPECAYDHLEVYDGRDAKAPALGRFCGSKKPEPVLA
TGSRMFLRFYSDNSVQRKGFQASHSTECGGQVRAEVKTKDLYSHAQFGDNNYPGGVDCEW
VIVAEEGYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGD
SVLVKFHSDDTITKKGFHLRYTSTKFQDTLHSRK
Download sequence
Identical sequences G1L9C5
ENSAMEP00000003497 ENSAMEP00000003497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]