SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003973 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003973
Domain Number 1 Region: 281-526
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.06e-89
Family Eukaryotic proteases 0.0000279
Further Details:      
 
Domain Number 2 Region: 191-287
Classification Level Classification E-value
Superfamily SRCR-like 1.14e-19
Family Hepsin, N-terminal domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000003973
Domain Number - Region: 170-194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00017
Family LDL receptor-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003973   Gene: ENSAMEG00000003744   Transcript: ENSAMET00000004134
Sequence length 534
Comment pep:known_by_projection scaffold:ailMel1:GL194201.1:219583:236261:-1 gene:ENSAMEG00000003744 transcript:ENSAMET00000004134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGQSPHRGPHLLERPSEGGSLDTCNQRKDPQAPGRWPTAVCPPLQAPVMNASPARTSPAR
ASPARSSPSRSSSARSASTASSPTRVYLVRATPVGAVPIRASPVRSPPATRATGESPGSS
LPKFTWQEGQKRLPLIGCVLLLIALVVSLIILLYFWRGHTGIKYKEPVESCPTHAVRCDG
VVDCKLRSDELGCVRFDWDTSLLKVYSGSSHQWLPICSDSWNDSYSEKTCQQLGFVSAYR
TTEVAHRDLASSFSISKYNSTLQESLYRSECPSQRYVSLQCSHCGLRAMMGRIVGGALAP
ESKWPWQISLHYGTTHICGGTLIDAQWVLTAAHCFFVTREKILEGWKVYAGTSNLLQLPE
AASISQIIINGNYTDEEDDYDIALLRLSKPLTLSAHIHPACLPMHGQTFSLNENCWITGF
GKTKETDEKTSPFLREVQVNLIDFKKCNDFLVYDSYLTPRMMCAGDLRGGRDSCQGDSGG
PLVCEQNSRWYLAGVTSWGTGCGQRNKPGVYTRVTEVLPWIYSKMEREVRFRKS
Download sequence
Identical sequences G1LAQ0
ENSAMEP00000003973 ENSAMEP00000003973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]