SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000004334 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000004334
Domain Number 1 Region: 804-912
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-25
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 19-145
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 258-374
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000628
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 377-423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000116
Family EGF-type module 0.019
Further Details:      
 
Domain Number 5 Region: 683-800
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000811
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 190-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000146
Family EGF-type module 0.023
Further Details:      
 
Domain Number 7 Region: 149-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000323
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000004334
Domain Number - Region: 616-666
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000879
Family Growth factor receptor domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000004334   Gene: ENSAMEG00000004061   Transcript: ENSAMET00000004506
Sequence length 990
Comment pep:known_by_projection scaffold:ailMel1:GL192464.1:1256488:1322383:1 gene:ENSAMEG00000004061 transcript:ENSAMET00000004506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGPGRLPGGGRLERSLADVDECAQGLDDCHTNALCQNTLTSYKCSCKPGFQGEGRQCEDI
DECENELNGGCVHDCLNIPGNYRCTCFDGFKLAHDGHNCLDVDECLENNGGCQHTCVNVM
GSYECRCKEGFFLSDNQHTCIHRLEEGLSCMNQNHGCSHICKEAPRGSVACECRPGFELA
KNQRDCILTCNHGNGGCQHSCEDTAEGPECSCHPQYQMHADGRSCLEREDTAPEAAESNA
TSVVDGDKRVKRRLLMETCAVNNGGCDRTCKDTSTGVHCSCPVGFTLQLDGKTCKDIDEC
QTRHGGCDHFCKNTVGSFDCSCKKGFKLLTDEKSCQDVDECSLDRTCDHSCINHPGTFTC
ACNKGYTLYGFTHCGADTNECSVNNGGCQQVCVNTVGSYECRCHSAYKLHWNKKDCVEVK
GVLPTSVSPQVSLRCGKSGGGDRCFLRCHSGIHLSSGPQEAYSVACGSSSSLRSKQQKSN
DSAFGEDDATIRTSVTFKLNEGKCSLKKEKQSSVKESFRYANLTCASSKQVPGAPGRPSA
TKEMFITVEFELETNQKEVTASCDLSCSVKRTEKRLRKAIRALRKAANREQFHLQLSGMD
LEGAKKSPRTSERRVQSCGVGQGHAGNQCVSCRAGTYYDGEQERCILCPNGTFQNEEGQI
TCEPCPRPENPGALKPPEAWNVSECGGLCQPGEYSADGFAPCQRCALGTFQPEAGRTSCF
PCGGGLPTKHLGATSFQDCETRVQCSPGHFYNTTNHRCIRCPAGTYQPEFGKNNCVSCPG
NTTTDFDGSTNITQCKDRRCGGELGDFTGYIESPNYPGNYPANTECTWTINPPPKRRILI
VVPEIFLPIEDDCGDYLVMRKTSSSNSVTTYETCQTYERPIAFTSRSKKLWIQFKSNEGN
SARGFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFK
YTAQESREMFPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences G1LBR0
ENSAMEP00000004334 ENSAMEP00000004334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]