SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000004563 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000004563
Domain Number 1 Region: 151-518
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.19e-94
Family Phosphonoacetate hydrolase 0.012
Further Details:      
 
Domain Number 2 Region: 621-887
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.59e-35
Family DNA/RNA non-specific endonuclease 0.0084
Further Details:      
 
Domain Number 3 Region: 57-103
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000405
Family Somatomedin B domain 0.0017
Further Details:      
 
Domain Number 4 Region: 105-146
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000379
Family Somatomedin B domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000004563   Gene: ENSAMEG00000004213   Transcript: ENSAMET00000004748
Sequence length 889
Comment pep:novel scaffold:ailMel1:GL194216.1:139610:216349:1 gene:ENSAMEG00000004213 transcript:ENSAMET00000004748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRSRFRSYQVISLFTFAVGVNICLGFTANRIKRAEGWDEGPPTVLSDSPWTNTSGSCK
GRCFELQEVGPPDCRCDNLCKSYSSCCHDFDELCLKTAGGWECTKDRCGEVRNEDNACHC
SEDCLARGDCCTNYQVVCKGETHWVDDNCEEIKAPECPAGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIIGNSMYDPVFDA
TFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDDER
PSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKTVGQLMDGLKQLKLHRCVNVIFVGDH
GMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKPDQH
FKPYMKQHLPKRLHYANNRRIEDIHLLVDRRWHVARKPLDVYKKPSGKCFFQGDHGFDNK
VNSMQTVFVGYGPTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTF
RPTMPEEVTRPNYPGIMYLQSDFDLGCNCDEKVELKKNKLDELNRRLHIKGSTEGEAPTF
RAGRSCNKENVNGNFEPRKERHLLYGRPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSY
TISKQAEVSSVPEYLTNCVRPDVRVSPSFSQSCLAYKNDKQMSYGFLFPPYLSSSPEAKY
DAFLVTNMVPMYPAFKRIWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTQDKIK
QYVEGSAVPVPTHYYSIATSCLDFTQPADKCDGPLSVSSFILPHRPDNEESCNSSEDESQ
WVEELIKMHTARVRDIEQLTSLDFFRKTSRSYPEILTLKTYLHTYESEI
Download sequence
Identical sequences G1LCD6
ENSAMEP00000004563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]