SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000004840 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000004840
Domain Number 1 Region: 327-577
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.14e-72
Family Eukaryotic proteases 0.00053
Further Details:      
 
Domain Number 2 Region: 113-223
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0061
Further Details:      
 
Domain Number 3 Region: 263-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 228-260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 5 Region: 48-108
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000162
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000004840   Gene: ENSAMEG00000004559   Transcript: ENSAMET00000005034
Sequence length 586
Comment pep:known_by_projection scaffold:ailMel1:GL194155.1:145888:182853:-1 gene:ENSAMEG00000004559 transcript:ENSAMET00000005034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKIKQIFMLALCLFCVLQLSLVSNTPQKDLVDKKCLTEKHTHLSCKKVFCQPWQKCIDGT
CICKLPYQCPKNGTLVCSTNGKTYSTYCQQKSFECLRPGAKFLNKGACRAEAQFNVSIKY
GNTTSEGIVEVKLVEQDKKMFICKKPWSMAEANVACLDLGFQQGAYDIQKQFEIPENLSM
NSTECLQVHCRGLETSLAECTFTKRRTKNDQDFAGVVCYTQNAAPPVNNSFHCVNGKYIP
QKRACNGINDCGDQSDELCCTGCQGKSFFCKSGVCIPSKYKCNGEVDCITGEDEIGCEVY
PSLDIEKTEFLTANMDEERKWIKSFLPKVSCGVKNSVPIRRKRVIGGKPAYMGDFPWQVA
IKENERIKCGGIYIGGCWIVTAAHCVSVSKMYHYQIWASFLNTLTPDGDVIVHLVKQIFI
HEKYNGSTYENDIALIELKKHSNKKDCELTNSIPVCVPWSSYLFQPNDKCTVSGWGREKD
NQKVHLLQWGEVTLINNCSRYYPGRYFEKEMDCAGTDDGSIDACKGDSGGPLVCKDVNNV
TYVWGVVSWGENCGRPEYPGVYTKVANYFDWISHHVGRSLISQYNV
Download sequence
Identical sequences G1LD59
ENSAMEP00000004840 ENSAMEP00000004840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]