SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000005393 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000005393
Domain Number 1 Region: 150-345
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.58e-60
Family Astacin 0.0000675
Further Details:      
 
Domain Number 2 Region: 777-884
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-37
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 3 Region: 466-570
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-37
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 4 Region: 352-461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-36
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 5 Region: 617-727
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-35
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 6 Region: 908-1001
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-27
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 7 Region: 725-769
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 8 Region: 573-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000005393   Gene: ENSAMEG00000005039   Transcript: ENSAMET00000005615
Sequence length 1012
Comment pep:novel scaffold:ailMel1:GL192820.1:748429:947636:-1 gene:ENSAMEG00000005039 transcript:ENSAMET00000005615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLETLPPRMLVWLVASGIVFYGELWVCAGLDYDYTFDGNEEDKAETIDYKDPCKAAVFW
GDIALDDEDLSIFQINRTIDLTQNPFGLGHTTGGFGDHVMSKKRGALYQLIDRIRRIGSG
LEQNSTVKGKVPLKFSGQDEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQA
MRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHE
LGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYAR
NTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGNLS
SPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLG
RFCGDKFPEILTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDD
YRPMKECVWKITVSEDYYVGLTFQAFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDK
PEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCAC
EPGYELGPDKRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMKFE
FFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFRSDNTVSKK
GFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHENKHDCKEAECEQKIHSP
NGLITSPNWPDKYPSRKECTWEISTTPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEK
SPILGRLCGNKIPEPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKADPKPRDLY
SHAQFGDNNYPGQVDCEWLLVSERGFRLELSFQIFEVEEEADCGYDYVELFDGLDSTAVG
LGRFCGSGPPEEIYSIGDAVLIHFHTDDTINKKGFHIRYKSIRYPDTMHTKK
Download sequence
Identical sequences D2HGS4
ENSAMEP00000005393 XP_002921361.1.58354 ENSAMEP00000005393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]