SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000005610 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000005610
Domain Number 1 Region: 772-1063
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.82e-70
Family Protein kinases, catalytic subunit 0.000000327
Further Details:      
 
Domain Number 2 Region: 159-316
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.65e-16
Family MAM domain 0.044
Further Details:      
 
Domain Number 3 Region: 1-108
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000222
Family MAM domain 0.01
Further Details:      
 
Domain Number 4 Region: 120-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000311
Family LDL receptor-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000005610   Gene: ENSAMEG00000005234   Transcript: ENSAMET00000005843
Sequence length 1269
Comment pep:known_by_projection scaffold:ailMel1:GL193053.1:588499:898998:-1 gene:ENSAMEG00000005234 transcript:ENSAMET00000005843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSFLLLNTSANSKHTILSPWVKSSSEHCRLAVSVHRHLQPSGRYVAQLLPHNEPGREILL
VPTPGKHGWTVLQGRIGRPENPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMAL
QSSFTCWNGTVLQLGQACDFHRDCAQGEDEGQLCSKLPAGFYCNFEDGFCGWTQGTLAPH
NPQWQIRTLKDVRGQDHRGHALLLSTTDVPTSESATVTSATFPAPMKNSPCELRMSWLIR
GVLRGNVSLVLVENKTGKEQSRMVWHVATNEGLSLWQWTVLPLLDVADRFWLQIVAWWGP
GSRATVAFDNISISLDCYLTISGEDKMPQNTAPKSRNLFERNPNKEPKVWENTRETPIFD
PTVHWLFTTCGASGPHGPTQAQCNNAYRNSNLSVVVGSEGPLKGIQTWKVPATDTYSISG
YGAAGGKGGKHTMMRSHGVSVLGIFNLEKGDTLYILVGQQGEDACPSTNRLIQKVCIGEN
NVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAAGGGGRAYGAKTDTFHA
ERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWSGKSLLEGATGGHSCPQAMKKWGWETR
GGFGGGGGGCSSGGGGGGYIGGNAASNNDPEIDGEDGVSFISPLGILYTPALKVMEGHGE
VNIKHYLNCSHCEGDECHMDPESHKVICFCDHGTVLADDGVSCIVSPTPEPHLPLSLVLS
VVTSALVAALVLAFSGIMIVYRRKHQELQAMQLELQSPEYKLSKLRTSTIVTDYNPNYCF
AGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGVPSDPXXLPFCAQTLPEVCSE
QDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMAGGDLKSFLRETRPRPNQP
SSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIY
RASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEV
LEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVIHTALP
VEYGPLLEEEEKVPVRPQDPEGIPPLLVSAPQAKREERQEAAAPPPLPSVSSGKAVKKPA
AAELSVRGARGPAAEGGHVNMAFSQSNPPSELHKVQGSRNKPTSLWNPTYGSWFTEKPAK
KNNPPAKKERHERGTPGREGSCTVAAPVAPGAPGASVLLEPSSLTASVKEVPLFRLRHFP
CGTVNYGYQ
Download sequence
Identical sequences G1LFC2
ENSAMEP00000005610 ENSAMEP00000005610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]