SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000005813 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000005813
Domain Number 1 Region: 230-388
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.72e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000074
Further Details:      
 
Domain Number 2 Region: 129-227
Classification Level Classification E-value
Superfamily LCCL domain 1.83e-25
Family LCCL domain 0.0008
Further Details:      
 
Domain Number 3 Region: 16-125
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-25
Family Spermadhesin, CUB domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000005813   Gene: ENSAMEG00000005509   Transcript: ENSAMET00000006057
Sequence length 542
Comment pep:known_by_projection scaffold:ailMel1:GL193571.1:100679:142112:1 gene:ENSAMEG00000005509 transcript:ENSAMET00000006057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIIFPPPIIAQHSGDGCGHIVTYQDSGTMTSKNYPGTYPNHTVCEKTIKVPKGKKLILRL
GDLDIESQTCASDYLLFTSSSDQYGPYCGSIPVPKELLLNTNEVTVRFESGSHISGRGFL
LTYASSDHPDLITCLERANHYLKTEYSKFCPAGCRDIAGDISGNLVDGYRDTSLLCKAAI
HAGVIADELGGQIHVLQSKGISRYEGILANGVLSRDGSLSDKRFLFTSDGCSRSLSLEPD
TQIRASWQWVSETGEQVHWSPGQAQLQDQDPSWASGDSGKTRRQREWLETDLGEKKKITG
IMTTGSTQSNFNFYVKSFVMKFKNNNSKWRTYKGIASNKEKVFQGNSNFRDPVRNNFIPP
IVARYVRVVPQTWHQRIALKVELFGCRITQGNDSLVFRKTSPNTVGSTEREDETITKSVP
SPEMPTGINSTAVAIPLVLLALLVAGMGIFAVLRRRKKKGNPYGSAKAQKTDCWKQIKYP
FARHQSAEFTISYDNEKEVTQKLDLITSDMADYQPPLMIGTETVTRKGSTFRPMDTEADE
AA
Download sequence
Identical sequences G1LFX4
ENSAMEP00000005813 ENSAMEP00000005813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]