SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006028 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006028
Domain Number 1 Region: 47-157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-31
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 2 Region: 259-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 450-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 164-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 411-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000013
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 212-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 374-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000733
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006028   Gene: ENSAMEG00000005717   Transcript: ENSAMET00000006277
Sequence length 859
Comment pep:novel scaffold:ailMel1:GL192538.1:708465:778465:-1 gene:ENSAMEG00000005717 transcript:ENSAMET00000006277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRWSTKESPRWRSALVLLFLAGVYGNGALAERSENVHISGVSTACGETPEQIRAPSGI
ITSPGWPSEYPAKINCSWFIRANPGEIITISFQDFDIQGSRRCSLDWLTIETYKNIESYR
ACGSTVPPPYISSQDHVWIRFHSDDSISRKGFRLAYFSGKSEEPNCACDQFRCGNGKCIP
EAWKCNSMDECGDGSDEEVCAREADPPTSASFQPCAYNQFQCLSRFTKVYTCLPESLKCD
GNIDCLDLGDEIDCDMPTCGQWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILR
FTDFKLDGTGYGDYVKIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVN
AARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDEINCTMCQKEEFPC
SRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGS
DEENCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAEL
LRREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLAVRSQLGFTSIRLPMAGRSS
NIWNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENE
RRDTAGASGGVAAPLPQKVPPTTAVEATVGASGSSSTPSTRGGHTENGRDATSVEPPGVS
PARHQLTSALSRMTQGLRWVRFTLGRSSSVNQNQSPLRQLDNGAHGREEDDDVEMLIPVS
DGASDFDVNDCSRPLLDLASDQGQGFRQPYSATNPGVRPSNRDGPCERCGIVHTAQIPDS
CLEATLKQETSDDEALLLC
Download sequence
Identical sequences D2H6W6
ENSAMEP00000006028 ENSAMEP00000006028 XP_002917521.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]