SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006346 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006346
Domain Number 1 Region: 8-49
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000523
Family Somatomedin B domain 0.0051
Further Details:      
 
Domain Number 2 Region: 47-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000602
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006346   Gene: ENSAMEG00000006028   Transcript: ENSAMET00000006607
Sequence length 237
Comment pep:novel scaffold:ailMel1:GL192952.1:1107595:1129559:-1 gene:ENSAMEG00000006028 transcript:ENSAMET00000006607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCPGRDAACFARGWRLDRVYGTCFCDQACRLTGDCCFDYARACPARPCIVGEWSPWSGCA
DQCKPAARVRRRPVQQEPRNGGAPCPPLEERAGCLDYSTARGQDCGHSFVPAFITTSAFN
KERTRHATSPQWSTDTEDTGYCMEFKTESLTHHCATENRPLTRWMQYLREGYTVCVDCQP
PAMNSESLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences D2HKG5
ENSAMEP00000006346 ENSAMEP00000006346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]