SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006378 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006378
Domain Number 1 Region: 136-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 96-132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 4-84
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000087
Family MAM domain 0.0063
Further Details:      
 
Domain Number 4 Region: 179-216
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000432
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006378   Gene: ENSAMEG00000006055   Transcript: ENSAMET00000006639
Sequence length 240
Comment pep:known_by_projection scaffold:ailMel1:GL192355.1:64283:109034:1 gene:ENSAMEG00000006055 transcript:ENSAMET00000006639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLLLFHFYLIQEDSLFIKIVYTIEESGLNILVWSVIGNKRTGWMYGHVPLSSNSAFKVA
FEADLAGEEDIFIALDDITFTPECVFGGPVAPQPSPCEADQFSCIYTLQCVPLLGKCNGQ
EDCVDGSDEMACALSPPPQHCGKMEFQCWSNECIPSLLLCDGVPDCHFNEDEAGCPNGSC
SDGALMCTSSNSCIPVHERCDGLANCMDFQLDESSCSECPLGYCRNGGNCIVEKNGPVCR
Download sequence
Identical sequences G1LHI3
ENSAMEP00000006378 ENSAMEP00000006378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]