SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006504 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006504
Domain Number 1 Region: 133-241
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 656-765
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-32
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 3 Region: 479-598
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-32
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 4 Region: 828-935
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 5 Region: 1008-1112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 6 Region: 301-416
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-23
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 7 Region: 1387-1455
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.76e-19
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 1627-1694
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.81e-18
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 9 Region: 1444-1511
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.7e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 10 Region: 770-838
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 11 Region: 1114-1187
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000417
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 12 Region: 1177-1244
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000082
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 13 Region: 1303-1367
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 14 Region: 597-659
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 15 Region: 1560-1620
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000598
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 16 Region: 73-136
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000973
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 17 Region: 1502-1570
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000256
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 18 Region: 1684-1741
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000417
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 19 Region: 246-313
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000594
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 20 Region: 940-1004
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000139
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 21 Region: 423-486
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000417
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 22 Region: 1-74
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000419
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 23 Region: 1248-1310
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000877
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006504   Gene: ENSAMEG00000006158   Transcript: ENSAMET00000006774
Sequence length 1754
Comment pep:known_by_projection scaffold:ailMel1:GL194872.1:323:120047:-1 gene:ENSAMEG00000006158 transcript:ENSAMET00000006774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHFLVFDTEEVHDVLRIWDGPVESGVLLKELSGTALPKDLHSTFNSVVLQFSTDFFTSKQ
GFAIHFSVSTATSCNDPGIPQNGSRSGDSWEAGDSTVFQCDPGYALQGSTEISCVKIDNR
FFWQPSPPTCIAPCGGDLTGPSGVILSPNYPEPYPPGKECDWKVTVSPDYVIALVFNIFN
LEPGYDFLHIYDGRDSLSPLIGSFYGSQLPGRIESSSNSLFLAFRSDASVSSAGFVIDYT
ENPRESCFDPGSIKNGTRVGSDLKLGSSITYYCHGGYEVEGTSTLSCVLGPDGKPAWNNP
RPMCTAPCGGQYVGSDGVVLSPNYPQNYTSGQICLYFVTVPKDYVVFGQFAFFHTALNDV
VEVHDGHSQHSRLLSSLSGSHTGESLPLATSNQVLIKFSAKGQAPARGFHFVYQAVPRTS
ATQCSSVPEPRYGKRLGSDFSVGAIVRFDCNSGYALQGSPEIECLPVPGALAQWNVSAPT
CVVPCGGNLTERRGTILSPGFPEPYLNSLNCVWKIMVPEGAGIQIQVISFVTEQNWDSLE
VFDGADNTVTMLGSFSGTTVPALLNSTSNQLYLHFYSDISVSAAGFHLEYKTVGLSSCPE
PAVPSNGVKTGERYLVNDVVSFQCEPGYALQGHAHISCMPGTVRRWNYPPPLCIAQCGGT
VEEMEGVILSPGFPGNYPSNMDCSWKIALPVGFGAHIQFLNFSTEPNHDFIEIRNGPYET
SRMMGRFSGSELPGSLLSTSHETTVYFHSDHSQNRPGFKLEYQAYELQECPDPEPFANGI
VRGAGYNVGQSVTFECLPGYQLIGHPVLTCQHGTNRNWDHPLPRCEVPCGGNITSSNGTV
YSPGFPSPYSSSQDCVWLITVPIGHGIRLNLSLLQTEPSGDFITVWDGAQQTAPQLGVFS
RSLAKKTLHSSSNQVLLKFHRDAAMGGIFAIAFSAYPLTKCPPPTILPNAEVVTENEEFN
IGDIVRYRCLPGFTLVGNEILTCKLGTYLQFEGPPPICEVHCPTNELLTDSTGVILSQSY
PGSYPQFQTCSWLVRVQPDYNISLTVEYFLSEKQYDEFEIFDGPSGQSPLLKALSGNYSA
PLIVTSSSNSVYLRWSSDHAYNRKGFKIRYSAPYCSLPRAPLHGFLLGQPSTQPGGSVHF
GCNAGYRLVGHSMAICTRHPQGYYLWSEAIPLCQALSCGLPQAPKNGMVFGKEYTVGTKA
VYSCSEGYHLQAGAEATAECLETGLWSNHNVPPQCVPVTCPDVSSISVEHGRWRLIFETQ
YQFQAQLMLICDPGYYYTGQRVIRCQANGKWSLGNSMPTCQIISCGALPVPPSGHRIGTL
SVYGATAIFSCNSGYTLVGSRVRECMANGLWSGSEVRCLAALTKPPLLFYKLLFDLHSSS
FPTKAGHCGTPEPIVNGHINGENYSYRGSVVYQCDAGFRLIGMSVRICQQDHLWSGKTPF
CVPITCGHPGNPINGLTQGNQFNLNDVVKFVCNPGYVAEGAARSQCLASGQWSDTLPTCR
IINCTDPGHQENSIRQVHASGPHRFSYGTTVSYQCSHGFYLLGTPVLGCQGDGTWDRPRP
QCLLVSCGHPGSPPHAQMSGDSFTVGAVVRYSCIGKRTLVGNATRMCGLDGHWTGSLPHC
SGASMGICGDPGTPAHGIRLGDSFAPGSLMRFSCEAGHTLRGSSERTCQANGSWSGTQPE
CGVISCGNPGTPSNARVMFSDGLGFSSSIVYECREGYYATGLLSRHCSVNGTWTGSDPEC
IGESPGPLGSVASG
Download sequence
Identical sequences G1LHV6
ENSAMEP00000006504 ENSAMEP00000006504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]