SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006506 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006506
Domain Number 1 Region: 133-241
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 656-765
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-32
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 3 Region: 479-598
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-32
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 4 Region: 828-935
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 5 Region: 1008-1112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 6 Region: 301-416
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-23
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 7 Region: 1362-1430
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.76e-19
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 1602-1669
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.67e-18
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 9 Region: 1419-1486
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.83e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 10 Region: 770-838
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000278
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 11 Region: 1114-1187
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000403
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 12 Region: 1177-1244
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000702
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 13 Region: 1303-1366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000806
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 14 Region: 597-659
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 15 Region: 1535-1595
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000598
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 16 Region: 73-136
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000959
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 17 Region: 1478-1545
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000256
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 18 Region: 1659-1716
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000403
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 19 Region: 246-313
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000058
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 20 Region: 940-1004
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000138
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 21 Region: 423-486
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000403
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 22 Region: 1-74
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000406
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 23 Region: 1248-1310
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000085
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006506   Gene: ENSAMEG00000006158   Transcript: ENSAMET00000006776
Sequence length 1729
Comment pep:known_by_projection scaffold:ailMel1:GL194872.1:323:120047:-1 gene:ENSAMEG00000006158 transcript:ENSAMET00000006776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHFLVFDTEEVHDVLRIWDGPVESGVLLKELSGTALPKDLHSTFNSVVLQFSTDFFTSKQ
GFAIHFSVSTATSCNDPGIPQNGSRSGDSWEAGDSTVFQCDPGYALQGSTEISCVKIDNR
FFWQPSPPTCIAPCGGDLTGPSGVILSPNYPEPYPPGKECDWKVTVSPDYVIALVFNIFN
LEPGYDFLHIYDGRDSLSPLIGSFYGSQLPGRIESSSNSLFLAFRSDASVSSAGFVIDYT
ENPRESCFDPGSIKNGTRVGSDLKLGSSITYYCHGGYEVEGTSTLSCVLGPDGKPAWNNP
RPMCTAPCGGQYVGSDGVVLSPNYPQNYTSGQICLYFVTVPKDYVVFGQFAFFHTALNDV
VEVHDGHSQHSRLLSSLSGSHTGESLPLATSNQVLIKFSAKGQAPARGFHFVYQAVPRTS
ATQCSSVPEPRYGKRLGSDFSVGAIVRFDCNSGYALQGSPEIECLPVPGALAQWNVSAPT
CVVPCGGNLTERRGTILSPGFPEPYLNSLNCVWKIMVPEGAGIQIQVISFVTEQNWDSLE
VFDGADNTVTMLGSFSGTTVPALLNSTSNQLYLHFYSDISVSAAGFHLEYKTVGLSSCPE
PAVPSNGVKTGERYLVNDVVSFQCEPGYALQGHAHISCMPGTVRRWNYPPPLCIAQCGGT
VEEMEGVILSPGFPGNYPSNMDCSWKIALPVGFGAHIQFLNFSTEPNHDFIEIRNGPYET
SRMMGRFSGSELPGSLLSTSHETTVYFHSDHSQNRPGFKLEYQAYELQECPDPEPFANGI
VRGAGYNVGQSVTFECLPGYQLIGHPVLTCQHGTNRNWDHPLPRCEVPCGGNITSSNGTV
YSPGFPSPYSSSQDCVWLITVPIGHGIRLNLSLLQTEPSGDFITVWDGAQQTAPQLGVFS
RSLAKKTLHSSSNQVLLKFHRDAAMGGIFAIAFSAYPLTKCPPPTILPNAEVVTENEEFN
IGDIVRYRCLPGFTLVGNEILTCKLGTYLQFEGPPPICEVHCPTNELLTDSTGVILSQSY
PGSYPQFQTCSWLVRVQPDYNISLTVEYFLSEKQYDEFEIFDGPSGQSPLLKALSGNYSA
PLIVTSSSNSVYLRWSSDHAYNRKGFKIRYSAPYCSLPRAPLHGFLLGQPSTQPGGSVHF
GCNAGYRLVGHSMAICTRHPQGYYLWSEAIPLCQALSCGLPQAPKNGMVFGKEYTVGTKA
VYSCSEGYHLQAGAEATAECLETGLWSNHNVPPQCVPVTCPDVSSISVEHGRWRLIFETQ
YQFQAQLMLICDPGYYYTGQRVIRCQANGKWSLGNSMPTCQIISCGALPVPPSGHRIGTL
SVYGATAIFSCNSGYTLVGSRVRECMANGLWSGSEVRCLAGHCGTPEPIVNGHINGENYS
YRGSVVYQCDAGFRLIGMSVRICQQDHLWSGKTPFCVPITCGHPGNPINGLTQGNQFNLN
DVVKFVCNPGYVAEGAARSQCLASGQWSDTLPTCRIINCTDPGHQENSIRQVHASGPHRF
SYGTTVSYQCSHGFYLLGTPVLGCQGDGTWDRPRPQCLLVSCGHPGSPPHAQMSGDSFTV
GAVVRYSCIGKRTLVGNATRMCGLDGHWTGSLPHCSGASMGICGDPGTPAHGIRLGDSFA
PGSLMRFSCEAGHTLRGSSERTCQANGSWSGTQPECGVISCGNPGTPSNARVMFSDGLGF
SSSIVYECREGYYATGLLSRHCSVNGTWTGSDPECIGESPGPLGSVASG
Download sequence
Identical sequences G1LHV8
ENSAMEP00000006506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]