SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006543 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006543
Domain Number 1 Region: 1524-1644
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-33
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 2 Region: 480-595
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-33
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 3 Region: 1697-1817
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 4 Region: 1180-1286
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-32
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 5 Region: 317-421
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-32
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 6 Region: 1868-1987
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-29
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 7 Region: 999-1120
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-29
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 8 Region: 140-250
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-28
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 9 Region: 2055-2158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-28
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 10 Region: 832-941
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 11 Region: 659-768
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-25
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 12 Region: 1347-1462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-22
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Domain Number 13 Region: 2408-2476
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.17e-20
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 14 Region: 2764-2835
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.62e-18
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 15 Region: 2465-2534
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.7e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 16 Region: 2648-2716
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.98e-18
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 17 Region: 2523-2597
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 18 Region: 2705-2775
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.34e-16
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 19 Region: 2882-2939
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.53e-16
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 20 Region: 2944-3012
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000027
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 21 Region: 1119-1183
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000058
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 22 Region: 2824-2893
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000783
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 23 Region: 2222-2289
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000113
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 24 Region: 256-317
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 25 Region: 426-493
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 26 Region: 1293-1357
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 27 Region: 2160-2233
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000283
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 28 Region: 944-1014
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000417
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 29 Region: 1469-1532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000737
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 30 Region: 2350-2412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000778
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 31 Region: 1815-1884
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000115
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 2580-2642
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000122
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 33 Region: 601-661
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 34 Region: 76-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 35 Region: 1643-1707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000032
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 36 Region: 774-834
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000702
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 37 Region: 1986-2050
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000243
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 38 Region: 2999-3060
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000709
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 39 Region: 2302-2354
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000931
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 40 Region: 1-39
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000196
Family Spermadhesin, CUB domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006543   Gene: ENSAMEG00000006174   Transcript: ENSAMET00000006818
Sequence length 3293
Comment pep:known_by_projection scaffold:ailMel1:GL192397.1:1913972:2649012:1 gene:ENSAMEG00000006174 transcript:ENSAMET00000006818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMMPSKDSSH
KNSVLSQGGVALVSDMCPDPGIPENGRKAGSDFSRVGANVQFSCEDNYVLQGSKSITCQR
VTETLAAWSDHRPICRARTCGSNLRGPSGVITSPNYPVQYEDNAHCVWVITTTDPDKVIK
LAFEEFELERGYDTLTVGDAGKVGDTRTVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIA
SPGFKAVYQEIEKGGCGDPGVPAYGKRAGSSFLHGDTLTFECQAAFELVGERVITCQQNN
QWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDV
EPQFDFLAIKDDGISDITVLGTFSGHEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTT
FGQNECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTV
PRCEAPCGGHLTASSGLILPPGWPGYYKDSLNCEWIIEAKPGHSIKITFDRFQTEVNYDT
LEVRDGPANSSPLIGEYHGTQAPQFLISTGHFMYLLFTTDNSRSSVGFLIHYESVTLESD
SCLDPGIPVNGHRHGSNFGIRSTVTFSCDPGYTLSDDEPLICERNHQWNHALPSCDALCG
GYIHGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGKGVQMIFHTFHLESSHDYLLITEDGS
FTEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVP
AFSRRIGFHFGVGDSLTFSCFPGYRLEGASQLTCLGGGRRVWSARLPRCVAECGASVKGN
EGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRARSFQLFEGDILKVYDGRDSSSRPLG
AFTRNELMGLVLNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRD
EGHFTDTVVLYSCNPGYAMHGSDTLTCLSGDRRVWDKPLPSCVAECGGQIHAATSGRILS
PGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTETAHDILKVWDGPVDSDILLKEWSGS
MLPEDTHSTFSSLTLQFDSDFFISKSGFSIQFSTSIASTCNDPGMPQNGTRYGDSREPGD
TITFQCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPY
PPGKECDWRIKVNPDFVIALIFKSFNMEPSYDFLHIYEGEDSNRPLLGSFQGSQAPERIE
SSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRIGTDFKLGSTVTYQCD
SGYKIVDPSSITCVIGTDGKPAWSQALPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQIC
LYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHPQARLLSSLSGSHSGETLPLATSNQI
LLRFSAKSGASARGFHFVYQAVPRTSDTQCSSIPEPRYGRRIGSEFSAGSIVRFECNPGY
LLQGSTAIRCQSVPNALAQWNDTIPSCIVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWK
IIVTEGSGIQIQVISFATEQNWDSLEIYDGGDMTAPRLGSFSGTTVPALLNSTSNQLYLH
FQSDISVAAAGFHLEYKTVGLAACQEPTLPSNGIKIGDRYMVNDVLSFQCEPGYTLQGRS
HISCMPGTVRRWNYPSPLCIATCGGTLSSMGGVILSPGFPGAYPNNLDCTWKIELPIGYG
AHIQFLNFSTEANHDYLEIQNGPYHTSPMIGQFSGSDPPSALLSTTHETLIHFYSDHSQN
RQGFKLAYQAYELQNCPDPPAFQNGYMINSDYSVGQSISFECYPGYILIGHPVLTCQHGI
NRNWNYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLL
QTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAYSSTNQVLLKFHSDFSNGGFFVLNFH
AFQLKKCQPPPAVPQAEMLTEDEDFEIGDFVKYQCHPGYTLSGMDTLTCKLSAQLQFEGS
LPTCEAQCPANEVRTESSGVILSPGYPGNYFNSQTCSWSIKVEPKYNITIFVDTFQSEKQ
FDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSKSNQLYLRWSTDHATSKKGFKIRYTAPY
CSLTHTPKNGGIFNRTTGALGSKVHYFCKPGYRMIGHSNATCRRNPGGMYQWDSLAPLCQ
AVSCGIPESPGNGSFTGNEFALDSKVTYECNEGFQLEAGQQAAAVCREDGLWNNTGKPPT
CKPVTCPSIEAQLSDHVTWRLVSGSLNEYGAQVVLSCSPGYYLEGPRLVQCQANGTWSVG
EERPRCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGM
ETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTP
VCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGASRAQCRSNGQWSSALPTC
RVVNCSDPGFVENAIRHGQQNFPESSEYGMSVMYHCKKGFYLLGSSALTCMANGLWDRSL
PKCLAISCGHPGVPANAILTGELFTYGAIVHYACKGSRDLVGNSTRICQEDSHWSGTLPH
CTGNDPGFCGDPGTPAHGSRLGDELKAKSLLRFSCEMGYQLRGSPERTCLLNGSWSGLQP
VCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLTTRHCTANGTWTGTAPD
CTVISCGDPGTLANGIQFGTDFTFNKTVSYQCDPGYLMEPITSSTIRCTKDSTWNNSKPV
CKAVVCGQPPQVPHGKVEGADFHWGASISYSCVDGFQPSHSAILSCEGHGVWKGEVPQCL
PVFCGDPGTPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRTCQADGTWSGTQPTCIDP
AHNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECI
PHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAAGSEHRTCKADMKWTGKSPVCK
SKGVREVNETVTKTPVPSDVFFINSVWKGYYEYLGKRQPATLTVDWFNATSSKVNATFLE
ASQVELKLTGVYKKEEAHLLLKAFQIKGPADIFVSKFENDNWGLAGYVSSGLERGGFTFQ
GDIHGKDFGKFKLERQDPLKSDQDSSNHYHGTSSGSVAAAILVPFFALILSGFAFYLYKH
RTRPKVQYNGYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences G1LHZ5
ENSAMEP00000006543 ENSAMEP00000006546 ENSAMEP00000006543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]