SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006551 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006551
Domain Number 1 Region: 1277-1397
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-33
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 2 Region: 233-348
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-33
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 3 Region: 1450-1570
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-32
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 4 Region: 933-1039
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-32
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 5 Region: 70-174
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-32
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 6 Region: 1621-1740
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-29
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 7 Region: 752-873
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-29
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 8 Region: 1808-1911
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-28
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 9 Region: 585-694
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 10 Region: 412-521
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-25
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 11 Region: 1100-1215
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-22
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Domain Number 12 Region: 2186-2254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-19
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 13 Region: 2243-2312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.43e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 14 Region: 2426-2494
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-18
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 15 Region: 2483-2553
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-16
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 16 Region: 2301-2375
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 17 Region: 2662-2719
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-16
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 18 Region: 2724-2792
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000027
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 19 Region: 2542-2601
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000324
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 20 Region: 2604-2673
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000445
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 21 Region: 872-936
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000556
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 22 Region: 1975-2042
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000104
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 23 Region: 9-70
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 24 Region: 179-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 25 Region: 1046-1110
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 26 Region: 1913-1986
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000027
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 27 Region: 697-767
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000389
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 28 Region: 1222-1285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000695
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 29 Region: 1568-1637
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000011
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 30 Region: 2358-2420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000115
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 31 Region: 354-414
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 32 Region: 1396-1460
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 33 Region: 2097-2158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 34 Region: 527-587
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000661
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 35 Region: 1739-1803
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000229
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 36 Region: 2783-2841
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000473
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 37 Region: 2055-2106
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000115
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006551   Gene: ENSAMEG00000006174   Transcript: ENSAMET00000006827
Sequence length 3085
Comment pep:known_by_projection scaffold:ailMel1:GL192397.1:2243937:2649012:1 gene:ENSAMEG00000006174 transcript:ENSAMET00000006827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSEIEKGGCGDPGVPAYGKRAGSSFLHGDTLTFECQAAFELVGERVITCQQNNQWSGNKP
SCVFSCFFNFTASSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFL
AIKDDGISDITVLGTFSGHEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECH
DPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPC
GGHLTASSGLILPPGWPGYYKDSLNCEWIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGP
ANSSPLIGEYHGTQAPQFLISTGHFMYLLFTTDNSRSSVGFLIHYESVTLESDSCLDPGI
PVNGHRHGSNFGIRSTVTFSCDPGYTLSDDEPLICERNHQWNHALPSCDALCGGYIHGKS
GTVLSPGFPDFYPNSLNCTWTIEVSHGKGVQMIFHTFHLESSHDYLLITEDGSFTEPVAR
LTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRRIG
FHFGVGDSLTFSCFPGYRLEGASQLTCLGGGRRVWSARLPRCVAECGASVKGNEGTLLSP
NFPSNYDNNHECIYKIETEAGKGIHLRARSFQLFEGDILKVYDGRDSSSRPLGAFTRNEL
MGLVLNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFTDT
VVLYSCNPGYAMHGSDTLTCLSGDRRVWDKPLPSCVAECGGQIHAATSGRILSPGYPAPY
DNNLHCTWIIEADPGKTISLHFIVFDTETAHDILKVWDGPVDSDILLKEWSGSMLPEDTH
STFSSLTLQFDSDFFISKSGFSIQFSTSIASTCNDPGMPQNGTRYGDSREPGDTITFQCD
PGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECD
WRIKVNPDFVIALIFKSFNMEPSYDFLHIYEGEDSNRPLLGSFQGSQAPERIESSGNSLF
LAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRIGTDFKLGSTVTYQCDSGYKIVD
PSSITCVIGTDGKPAWSQALPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVP
KEFVVFGQFAYFQTALNDLAELFDGTHPQARLLSSLSGSHSGETLPLATSNQILLRFSAK
SGASARGFHFVYQAVPRTSDTQCSSIPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGSTA
IRCQSVPNALAQWNDTIPSCIVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGS
GIQIQVISFATEQNWDSLEIYDGGDMTAPRLGSFSGTTVPALLNSTSNQLYLHFQSDISV
AAAGFHLEYKTVGLAACQEPTLPSNGIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCMPG
TVRRWNYPSPLCIATCGGTLSSMGGVILSPGFPGAYPNNLDCTWKIELPIGYGAHIQFLN
FSTEANHDYLEIQNGPYHTSPMIGQFSGSDPPSALLSTTHETLIHFYSDHSQNRQGFKLA
YQAYELQNCPDPPAFQNGYMINSDYSVGQSISFECYPGYILIGHPVLTCQHGINRNWNYP
FPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQTEAVND
YIAVWDGPDQNSPQLGVFSGNTALETAYSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKC
QPPPAVPQAEMLTEDEDFEIGDFVKYQCHPGYTLSGMDTLTCKLSAQLQFEGSLPTCEAQ
CPANEVRTESSGVILSPGYPGNYFNSQTCSWSIKVEPKYNITIFVDTFQSEKQFDALEVF
DGSSGQSPLLVVLSGNHTEQSNFTSKSNQLYLRWSTDHATSKKGFKIRYTAPYCSLTHTP
KNGGIFNRTTGALGSKVHYFCKPGYRMIGHSNATCRRNPGGMYQWDSLAPLCQAVSCGIP
ESPGNGSFTGNEFALDSKVTYECNEGFQLEAGQQAAAVCREDGLWNNTGKPPTCKPVTCP
SIEAQLSDHVTWRLVSGSLNEYGAQVVLSCSPGYYLEGPRLVQCQANGTWSVGEERPRCR
VISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGMETRCLGK
FIYLNRFSYPLLLFILSGRVISKPGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLV
GTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGA
SRAQCRSNGQWSSALPTCRVVNCSDPGFVENAIRHGQQNFPESSEYGMSVMYHCKKGFYL
LGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAILTGELFTYGAIVHYACKGSRDLVG
NSTRICQEDSHWSGTLPHCTGNDPGFCGDPGTPAHGSRLGDELKAKSLLRFSCEMGYQLR
GSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSG
LTTRHCTANGTWTGTAPDCTVISCGDPGTLANGIQFGTDFTFNKTVSYQCDPGYLMEPIT
SSTIRCTKDSTWNNSKPVCKETAVVCGQPPQVPHGKVEGADFHWGASISYSCVDGFQPSH
SAILSCEGHGVWKGEVPQCLPVFCGDPGTPAEGRLSGKSFTYKSEVFFQCKSPFILVGSS
RRTCQADGTWSGTQPTCIDPAHNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQG
STTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAAG
SEHRTCKADMKWTGKSPVCKIVGKGVREVNETVTKTPGLYTRTAVPSDVFFINSVWKGYY
EYLGKRQPATLTVDWFNATSSKVNATFLEASQVELKLTVGVYKKEEAHLLLKAFQIKGPA
DIFVSKFENDNWGLAGYVSSGLERGGFTFQGDIHGKDFGKFKLERQGNYPLKSDQDSSNH
YHGTSSGSVAAAILVPFFALILSGFAFYLYKHRTRPKVQYNGYAGHENSNGQASFENPMY
DTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences G1LI03
ENSAMEP00000006551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]