SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007022 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007022
Domain Number 1 Region: 350-458
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 701-810
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 3 Region: 868-988
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-32
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 4 Region: 1039-1158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-30
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 5 Region: 170-286
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-28
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 6 Region: 1227-1331
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-26
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 7 Region: 3-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 8 Region: 518-633
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-25
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 9 Region: 1934-2005
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-21
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 10 Region: 1579-1647
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.72e-19
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 11 Region: 1636-1704
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 12 Region: 1875-1945
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.75e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 13 Region: 1694-1767
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.13e-18
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 14 Region: 1818-1886
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.31e-17
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 15 Region: 1520-1589
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.92e-17
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 16 Region: 1994-2063
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.71e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 17 Region: 986-1055
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000012
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 18 Region: 1393-1460
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 19 Region: 1750-1811
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 20 Region: 2114-2182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2053-2109
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 22 Region: 1331-1404
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000114
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 23 Region: 814-876
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000243
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 24 Region: 290-354
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000283
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 25 Region: 463-528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000639
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 26 Region: 640-706
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 27 Region: 116-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000848
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 28 Region: 2173-2231
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000125
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 29 Region: 1467-1531
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000337
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 30 Region: 1157-1220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007022   Gene: ENSAMEG00000006646   Transcript: ENSAMET00000007319
Sequence length 2470
Comment pep:novel scaffold:ailMel1:GL193515.1:289808:608065:-1 gene:ENSAMEG00000006646 transcript:ENSAMET00000007319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAECGASATNNEGILLSPNYPLNYENNHECIYSIQVQAGKGINISSRTFHLAQGDVLKIY
DGKDKTTHLLGAFTGASMRGLTLSSTSNQLWLEFNSDSEGTDEGFQLVYTSFELSHCEDP
GIPQFGYKISDQGHFAGSTIIYGCNPGYTLHGSSLLKCMTGERRAWDYPLPSCIAECGGR
FKGESSGRILSPGYPFPYDNNLRCMWVIEVDPGNIVSLQFLAFDTEASHDILRVWDGPPE
NEMLLKEISGSLIPEGIHSTLNIVTIQFDTDFYISKSGFAIQFSSSVATACRDPGVPMNG
TRNGDGREPGDTVVFQCDPGYELQGEERITCIQVENRYFWQPSPPVCIAPCGGNLTGSSG
FILSPNFPHPYPHSRDCDWTITVNTDYVISLAFISFSIEPNYDFLYIYDGPDSNSPLIGS
FQDSKLPERIESSSNTMHLAFRSDGSVSYTGFHLEYKAKLRESCFDPGNIMNGTRLGMDY
KLGSTVTYYCDAGYVLQGYSTLTCIMGDDGRPGWNRALPSCHAPCGSRSTGSEGTVLSPN
YPKNYSVGHNCVYSIAVPKEFVVFGQFVFFQTSLHDVVEVYDGPTQQSSLLSSLSGSHSG
ESLPLSSGNQITIRFTSVGPITAKGFHFVYQAVPRTSSTQCSSVPEPRFGRRIGNEFAVG
SLVLFECNPGYILHGSIAIRCDTVPNSLAQWNDSLPTCIVPCGGILTKRKGTILSPGYPE
PYDNNLNCVWKITVPEGAGIQVQVVSFATEHNWDSLDFYDGGDNNAPRLGSYSGTTIPHL
LNSTSNNLYLNFQSDISVSAAGFHLEYTAIGLDSCPEPQTPSSGMKIGDRYMVGDVVSFQ
CDQGYSLQGHSHITCMPGPVRRWNYPIPICLAQCGGAMSDFSGVILSPGFPGNYPSSLDC
TWTIKLPVGFGVHLQFVNFSTETIHDYLEVRSGSSETSTVIGRLSGPQIPSSLFSTTHET
SLYFHSDYSQNKQGFHIVYQAYQLQSCPDPRPFRNGFVIGNDFTVGQTISFECFPGYTLI
GNSALTCLHGVSRNWNHPLPRCEALCGGNITAMNGTVYSPGYPDEYPNFQDCFWLVRIPP
GNGIYINFTVLQTEPIYDFITVWDGPDQNSPQIGQFSGNTALESVYSTSNQILIKFHSDF
TTSGFFVLSYHAYQLRVCQPPPPVPNAEILTEDDEFEIGDIIRYQCLPGFTLVGNAILTC
RLGERLQMDGAPPVCQVLCPANELRLDSTGVILSPGYPDSYPNLQMCAWSISVEKGYNIS
MFVEFFQTEKEFDVLQVYDGPNIQSPVLISLSGDYSSAFNITSNGHEVFLQWSADHGNNK
KGFRIRYIAFYCSTPESPPHGYIISQTGGQLNSVVRWACDRGFRLVGKSSAVCRKSSYGY
HAWDAPVPACQAISCGIPKAPTNGGILTTDYLVGTRVTYFCNDGYRLSSKELTTAICQSD
GTWSNHNKTPRCVVVTCPSINSFTLEHGRWRIVNGSHYEYKTKVVFSCDPGYHGLGPASI
ECLPNGTWSWRNERPYCQIISCGELPTPPNGNKIGTQTSYGSTAIFTCDSGFMLVGSAVR
ECLSSGLWSGSETKCLAGHCGIPELIVNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRIC
QQDHNWSGQLPSCVPVSCGHPGSPIYGRTSGNGFNFNDVVTFSCNIGYVMQGPTKAQCQA
NRQWSHPPPVCKVVNCSDPGIPANSKRESKIEHGNFTYGTLVFYDCNPGYFLFGSSVLIC
QPNGQWDKPLPECIMIDCGHPGVPPNAVLSGEKYTFGSTVHYSCTGKRTLLGQSSRTCQL
NGHWSGSQPHCSGDATGTCGDPGTPGHGSRQESDFRTKSSVRFACDIGYILHGSEERTCL
ANGSWTGRQPECKAVQCGNPGTTANGKVFRIDGTTFSSSVIYSCMEGYILSGPSVRQCTA
NGTWSGTLPNCTIISCGDPGIPANGLRYGDDYVVGQNVSYMCQPGYTMELNGSRIRTCTT
NGTWSGVMPTCRAVTCSTPPQISNGRLEGTNFDWGFSISYICSPGYELSFPAILTCVGNG
TWSGEVPQCLPKFCGDPGIPAQGKREGKSFIYQSEVSFSCNSPFILVGSSTRICQADGMW
SGSSPHCIEPTRTSCENPGVPRHGSQNNTFGFQVGSVVQFHCKKGHLLQGSTTRTCLPDL
TWSGIQPECIPHSCKQPETPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDN
TWTGKVPVCEAGSKILVKDPRPALGTPSPKLSVPDDVFAQNYIWKGSYNFKGRKQPMTLT
VTSFNASTGRVNATLSNSNMELLLSGVYKSQEARLMLHIYFIKVPTHASVKKMKEDNWAM
DGFVSAEPDGATYVFQGFIQGKDYGQFGLQRLGLNTSEGSNSSNQPHGTNSSSVAIAILV
PFFALIFAGFGFYLYKQRTAPKTQYTGCSVHENNNGQAAFENPMYDTNAKSVEGKAVRFD
PNLNTVCTMV
Download sequence
Identical sequences G1LJB7
ENSAMEP00000007022 ENSAMEP00000007022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]