SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007177 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007177
Domain Number 1 Region: 803-911
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-24
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 284-409
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 6-138
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 247-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000644
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 661-800
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000314
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 178-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000248
Family EGF-type module 0.032
Further Details:      
 
Domain Number 7 Region: 137-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.021
Further Details:      
 
Domain Number 8 Region: 619-669
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000576
Family Growth factor receptor domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007177   Gene: ENSAMEG00000006809   Transcript: ENSAMET00000007482
Sequence length 989
Comment pep:known_by_projection scaffold:ailMel1:GL193026.1:548309:679128:1 gene:ENSAMEG00000006809 transcript:ENSAMET00000007482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPADVDECSEGTDDCHIDAICQNTPKSYKCLCKPGYKGEGRQCEDIDECENDYYNGGCV
HECINIPGNYRCTCFDGFMLAHDGHNCLDVDECQDNNGGCQQICVNAMGSYECQCHSGFF
LSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKGGVACDCRPGFDLAQNQKDCTLTCNY
GNGGCQHSCEDTDTGPMCGCHQKYALHSDGRTCIEKDEAAIERSQFNATSVADVDKRVKR
RLLMETCAVNNGGCDRTCRDTATGVRCSCPVGFTLQPDGKTCKDINECLANNGGCDHFCR
NTVGSFECGCRKGYKLLTDERTCQDIDECSFERTCDHICINSPGSFQCLCHRGYTLYGTT
HCGDVDECSMNNGSCDQGCVNTKGSYECVCPPGRRLHWNRKDCVETGKCLSRAKASPWAQ
LSCSKVGGVESCSLSCPAHSLFVPDSDNSYSLSCGVPGLQGKMPPKRNGTGSSTGPSCAG
VPAPIRQKARFKIRDAKCHLRPHGREPAKETLRQLLLENCHLTFVTLKCDSSKKRRRGKK
SPSKEVTHITAEFEVETKMEEASDTCEADCMRKRAEQSLQAAIKTLRKSVGRHHFSVQVA
GTEYAMSQWPAKALEGQGACSTGQVLQDGKCVACGPGTYFSGDPGQCVPCAPGSYQDRDG
QLSCTPCPSSDGLGLAGARNVSECGGQCSPGFFSPDGFRPCQACPVGTYQPEPGRTGCFP
CGGGLLTKHEGTVSFQDCEAKVHCSPGHHYNTSTHRCVRCPVGTYQPEFGQNHCISCPGN
TSTDFDGSTNVTHCKNQHCGGELGDYTGYIESPNYPGDYPANAECVWHISPPPKRRILIV
VPEIFLPVEDECGDVLVMRKSASPASITTYETCQTYERPIAFTSRSRKLWIQFKSNEGNS
GKGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFRY
TAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences G1LJS0
ENSAMEP00000007177 ENSAMEP00000007177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]