SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007178 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007178
Domain Number 1 Region: 773-881
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-24
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 254-379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.24e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 6-138
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 161-296
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000121
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 632-770
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000105
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 589-639
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000068
Family Growth factor receptor domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007178   Gene: ENSAMEG00000006809   Transcript: ENSAMET00000007483
Sequence length 959
Comment pep:known_by_projection scaffold:ailMel1:GL193026.1:548309:679128:1 gene:ENSAMEG00000006809 transcript:ENSAMET00000007483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPADVDECSEGTDDCHIDAICQNTPKSYKCLCKPGYKGEGRQCEDIDECENDYYNGGCV
HECINIPGNYRCTCFDGFMLAHDGHNCLDVDECQDNNGGCQQICVNAMGSYECQCHSGFF
LSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKGGVACDCRPGFDLAQNQKDCTLTCNY
GNGGCQHSCEDTDTGPMCGCHQKYALHSDGRTCIETCAVNNGGCDRTCRDTATGVRCSCP
VGFTLQPDGKTCKDINECLANNGGCDHFCRNTVGSFECGCRKGYKLLTDERTCQDIDECS
FERTCDHICINSPGSFQCLCHRGYTLYGTTHCGDVDECSMNNGSCDQGCVNTKGSYECVC
PPGRRLHWNRKDCVETGKCLSRAKASPWAQLSCSKVGGVESCSLSCPAHSLFVPDSDNSY
SLSCGVPGLQGKMPPKRNGTGSSTGPSCAGVPAPIRQKARFKIRDAKCHLRPHGREPAKE
TLRQLLLENCHLTFVTLKCDSSKKRRRGKKSPSKEVTHITAEFEVETKMEEASDTCEADC
MRKRAEQSLQAAIKTLRKSVGRHHFSVQVAGTEYAMSQWPAKALEGQGACSTGQVLQDGK
CVACGPGTYFSGDPGQCVPCAPGSYQDRDGQLSCTPCPSSDGLGLAGARNVSECGGQCSP
GFFSPDGFRPCQACPVGTYQPEPGRTGCFPCGGGLLTKHEGTVSFQDCEAKVHCSPGHHY
NTSTHRCVRCPVGTYQPEFGQNHCISCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYI
ESPNYPGDYPANAECVWHISPPPKRRILIVVPEIFLPVEDECGDVLVMRKSASPASITTY
ETCQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYA
SENHQEILKDKKLIKALFDVLAHPQNYFRYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences G1LJS1
ENSAMEP00000007178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]