SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007221 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007221
Domain Number 1 Region: 63-183,259-363
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.71e-60
Family FabD-like 0.0000947
Further Details:      
 
Domain Number 2 Region: 191-266
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000118
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007221   Gene: ENSAMEG00000006855   Transcript: ENSAMET00000007526
Sequence length 376
Comment pep:known_by_projection scaffold:ailMel1:GL193026.1:730039:738423:1 gene:ENSAMEG00000006855 transcript:ENSAMET00000007526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APARVSRSAWIPAGPQRAAARTLGAGAELVRAEPFFPPPGAAARPAGNASGTAPCRAAAA
XSVLLFPGQGSQVVGMGRGLLRYPRVRELYAAARSVLGYDLLELSLHGPQEALDRTAHCQ
PAVFVASLPGPERHVPRLSPQVIENCVAAAGFSVGEFAALVFAGAMEFSEGLYAVKVRAE
AMQEASEAVPSGMLSVLGQSQSKFAFACLEAREHCKTLGIENPVCEVANYLFPDCRVISG
HLEALQFLQKNASRYHFRRTRRLPVSGGFHTRLMEPALEPLAHVLKSVSVKKPLVSVHSN
VDGNRYAHPKHIPKALVQQVVSPVKWEQTMHAIYERRRGTEFPKTFEVGPGRQLGSILKS
CNLQAWKSYRHVDVLE
Download sequence
Identical sequences G1LJW2
ENSAMEP00000007221 ENSAMEP00000007221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]