SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007394 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007394
Domain Number 1 Region: 21-92
Classification Level Classification E-value
Superfamily EndoU-like 2.09e-29
Family Eukaryotic EndoU ribonuclease 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007394   Gene: ENSAMEG00000007029   Transcript: ENSAMET00000007704
Sequence length 157
Comment pep:novel scaffold:ailMel1:GL192902.1:1202721:1206744:-1 gene:ENSAMEG00000007029 transcript:ENSAMET00000007704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRTASTKKLYIFLYYYYLTDRYISEQEFVSDLKNMWFGLYSRGNEEEDSSGFEHVFSGEI
KKGKVTGFHNWIRFYMQEKEGLVDYYSHIYDGPVPVKPGWLSLGHPDVSLGQVHLRKRQE
IHRHSLCGVFHPIELGAGESHEGSESSCRTQGLSARG
Download sequence
Identical sequences G1LKD4
ENSAMEP00000007394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]