SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007401 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007401
Domain Number 1 Region: 134-166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000103
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 74-122
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000034
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007401   Gene: ENSAMEG00000007016   Transcript: ENSAMET00000007711
Sequence length 491
Comment pep:known_by_projection scaffold:ailMel1:GL195537.1:9583:36413:1 gene:ENSAMEG00000007016 transcript:ENSAMET00000007711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESQQKLRHTLKMKTSGLQAWGAPAELILLCAALGSLGLPGSRGERPHSLESNAVNESLAK
SRQTRSVGVTLMPIDCELSSWSSWTTCDPCQKKRYRHAYWLRPSQFYGEPCNFSDKEVED
CVTSRPCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCKRIYKKCQHEMDQY
WAIGRLASGINLFTNRFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVDSYDPQTQGKYEF
ALTEYESYSDFEHNVTETRASVSSFGFGFKIPGIFELGFNTASGNGKQFISRTKRFSHTK
STFLHARSDLEIARYKLKPRSLMLHYEFLQRVKALPLEYSYGEYRDLFRDFGTHYITEAV
LGGVYEYTLVMNKEAMERADYSLKDVRACAQNGFRIGIGIEVVYVKLGVSVDICRGILNE
IGDRNKRNTMVDDLVVLVRGGASEHITTLAYKELPTADLMQEWGDAVQYNPDIIKIKVQE
SLFPLLISFSF
Download sequence
Identical sequences G1LKE1
ENSAMEP00000007401 ENSAMEP00000007401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]